KEGG   Bacillus subtilis subsp. subtilis 168: BSU15640
Entry
BSU15640          CDS       T00010                                 

Symbol
yloA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: NFACT_N NFACT-R_1 NFACT-R_2 Glyco_hydro_106
Other DBs
NCBI-GeneID: 936878
NCBI-ProteinID: NP_389447
Pasteur: BG13383
BSORF: BG13383
UniProt: O34693 A0A6M4JI41
Position
complement(1636131..1637849)
AA seq 572 aa
MHMSFDGMFTYGMTHELNEKIMGGRITKIHQPYKHDVIFHIRAKGKNQKLLLSAHPSYSR
VHITAQAYENPSEPPMFCMLLRKHIEGGFIEKIEQAGLDRIMIFHIKSRNEIGDETVRKL
YVEIMGRHSNIILTDAAENVIIDGLKHLSPSMNSYRTVLPGQDYKLPPAQDKISPLEASE
DDILRHLSFQEGRLDKQIVDHFSGVSPLFAKEAVHRAGLANKVTLPKALLALFAEVKEHR
FIPNITTVNGKEYFYLLELTHLKGEARRFDSLSELLDRFYFGKAERDRVKQQAQDLERFV
VNERKKNANKIKKLEKTLEYSENAKEFQLYGELLTANLYMLKKGDKQAEVINYYDEESPT
ITIPLNPNKTPSENAQAYFTKYQKAKNSVAVVEEQIRLAQEEIEYFDQLIQQLSSASPRD
ISEIREELVEGKYLRPKQQKGQKKQKPHNPVLETYESTSGLTILVGKNNRQNEYLTTRVA
ARDDIWLHTKDIPGSHVVIRSSEPDEQTIMEAATIAAYFSKAKDSSSVPVDYTKIRHVKK
PNGAKPGFVTYDSQHTVFVTPDADTVIKLKKS
NT seq 1719 nt   +upstreamnt  +downstreamnt
ttgcatatgtcgtttgatggcatgtttacatacggaatgacacacgaacttaacgagaaa
ataatgggcggacgaattacaaaaatccatcagccatataagcacgatgtgattttccac
atccgtgccaagggaaaaaaccaaaaactattattatcggcacatccgagctattcacgg
gtgcatatcacggcacaagcttatgaaaatccaagcgaaccgccaatgttttgcatgttg
ctgagaaagcatatcgaaggcggattcattgagaaaattgaacaagcgggcttagaccgc
attatgatttttcatatcaaaagccgaaacgaaattggcgatgaaaccgtacgaaagctt
tatgtagaaattatgggccgccacagcaatatcattttgactgacgcagcagaaaatgtg
attatcgacggacttaagcatttatcaccgtcaatgaacagctaccgtacagtactgccc
ggccaagattataagcttccgcctgctcaggacaaaatatcgcctcttgaggcgtcagaa
gatgatattttgcgtcacctcagctttcaagaaggaaggcttgataaacaaattgtcgac
cacttttcaggcgtgtctccgcttttcgccaaagaagcggttcacagagcaggccttgcc
aacaaagtcacactgccaaaagcgttgctggcactgtttgccgaagtgaaagagcaccgt
ttcattcccaacattacgactgtaaacggaaaggaatatttttatctgctggagctgact
catctaaagggcgaagcgcgccgttttgattcattaagcgaactgctcgaccgtttttat
ttcggaaaagctgaacgagaccgggttaagcaacaggctcaggatcttgagcgttttgtt
gtgaacgaacggaagaagaatgccaacaaaatcaaaaaattagagaaaaccctggagtat
tcggaaaacgcgaaggaatttcagctttacggagagcttttaaccgctaatttatatatg
ctgaaaaaaggtgataaacaggctgaggtcatcaattattatgatgaagaaagcccgaca
atcacgattcctttaaacccgaacaaaacgccttctgaaaacgcacaggcctatttcacg
aagtatcagaaagcgaaaaattcggtcgcagttgtcgaggagcaaatcaggctggcacag
gaagagatcgaatattttgatcagctgattcagcagctttcgtccgcttctccccgggat
atcagcgaaatcagggaagagcttgttgagggcaaatatttacgccctaagcagcaaaaa
ggccagaaaaagcaaaaaccgcacaatccggtgttagaaacatatgaatccacctcaggg
ctgacaattttagtgggtaagaacaatcgtcaaaatgaatatttaacgacaagagtggcg
gccagagacgatatctggcttcacacgaaggacattcccggctcccacgttgtgatcaga
agcagcgaacctgatgagcaaacaatcatggaagccgcgacaattgcagcttatttttca
aaagctaaagattcaagttcagtgcctgtagattatacaaaaatcaggcatgtcaaaaaa
ccaaacggcgcgaaacccggtttcgtcacttatgacagccagcataccgtctttgtcacg
cctgatgctgatactgtcatcaagctcaaaaaaagctga

DBGET integrated database retrieval system