KEGG   Bacillus subtilis subsp. subtilis 168: BSU16050
Entry
BSU16050          CDS       T00010                                 

Symbol
rbgA
Name
(RefSeq) ribosome biogenesis GTPase A
  KO
K14540  ribosome biogenesis GTPase A
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU16050 (rbgA)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  GTPases
   BSU16050 (rbgA)
SSDB
Motif
Pfam: MMR_HSR1 FeoB_N RsgA_GTPase Arf GTP_EFTU MeaB AAA_18 SRPRB Dynamin_N Roc AAA_16 TniB AIG1 AAA_14
Other DBs
NCBI-GeneID: 940134
NCBI-ProteinID: NP_389487
Pasteur: BG13405
BSORF: BG13405
UniProt: O31743 A0A6M3ZAQ9
Structure
PDB: 
1PUJ 6PPK

Position
1676532..1677380
AA seq 282 aa
MTIQWFPGHMAKARREVTEKLKLIDIVYELVDARIPMSSRNPMIEDILKNKPRIMLLNKA
DKADAAVTQQWKEHFENQGIRSLSINSVNGQGLNQIVPASKEILQEKFDRMRAKGVKPRA
IRALIIGIPNVGKSTLINRLAKKNIAKTGDRPGITTSQQWVKVGKELELLDTPGILWPKF
EDELVGLRLAVTGAIKDSIINLQDVAVFGLRFLEEHYPERLKERYGLDEIPEDIAELFDA
IGEKRGCLMSGGLINYDKTTEVIIRDIRTEKFGRLSFEQPTM
NT seq 849 nt   +upstreamnt  +downstreamnt
atgacaattcaatggttcccgggccatatggcaaaagcaagaagggaagtaaccgaaaaa
ttaaaattaatcgatatcgtatatgaattggtagatgccagaattccaatgtcatcaaga
aacccaatgattgaagatattctaaaaaacaagccgcgaattatgctgttaaacaaggct
gacaaagcagatgcggcagttacacagcagtggaaagagcactttgagaaccaggggatc
cgctctctgtctattaattctgtaaatggacaagggttaaatcaaattgtgcctgcatca
aaagagatcctccaagaaaaatttgaccggatgcgtgcgaaaggtgtgaagccgagagcg
attcgcgctttgattatcggcattccaaacgtcggaaaatcaacgctcatcaaccggctt
gcaaagaaaaacatagcaaaaacgggagacagacctggtattacgacttctcaacagtgg
gtcaaagttgggaaagaattagagctattagatacaccgggaattttgtggcctaaattt
gaggatgagcttgtcggtttgagactggcagtcaccggggctattaaagactcgattatc
aatttgcaggacgtggccgtgtttggtcttcgttttctcgaagaacattacccagaacgg
cttaaagagcgttatggccttgatgagatcccagaggacattgccgagctgtttgatgca
ataggtgaaaagcggggctgtctcatgagcggtgggctcatcaactacgataagacgact
gaagtcatcattcgcgatattcgcactgaaaagttcggcaggctgtcatttgaacagccg
acgatgtaa

DBGET integrated database retrieval system