KEGG   Bacillus subtilis subsp. subtilis 168: BSU16340
Entry
BSU16340          CDS       T00010                                 

Symbol
fliZ
Name
(RefSeq) flagellar biosynthetic protein FliZ
  KO
K02418  flagellar protein FliO/FliZ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    BSU16340 (fliZ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsu02044]
    BSU16340 (fliZ)
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16340 (fliZ)
Secretion system [BR:bsu02044]
 Type III secretion system
  Flagellar export apparatus
   BSU16340 (fliZ)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    BSU16340 (fliZ)
SSDB
Motif
Pfam: FliO Nucleoside_tran DHHC Orf78
Other DBs
NCBI-GeneID: 936796
NCBI-ProteinID: NP_389516
Pasteur: BG10259
BSORF: BG10259
UniProt: P35536
Position
1704211..1704870
AA seq 219 aa
MKKSQYFIVFICFFVLFSVHPIAAAAADSDNSTVNEWFQKKDEKTADQSEQKKEKTTKTA
DETEGAAAPSVSAFDFVKMIFALLFVIVLIYGLVKLMNKRNRLLKPFQYVENIGGTSVGQ
NRSIQLIKVGKSVLVVGVGETIQLLKEIEDEKEIEVILSQHEEAMSSKIEWQKFVKPLKS
SEHQPQQKLPSFSKALKEQLEELKQNRSEGKKKGPRHHE
NT seq 660 nt   +upstreamnt  +downstreamnt
ttgaaaaagagtcaatattttattgtttttatttgttttttcgttttattcagtgtacat
ccgattgctgctgccgcggcagactctgataattcaactgtaaacgaatggtttcaaaag
aaagatgaaaaaactgcagatcaatcagagcaaaagaaagaaaaaacaacaaaaactgct
gatgagacggagggagcggctgctccttctgtctcagcttttgattttgtaaagatgatt
ttcgctttactgtttgttatcgtgctgatttacgggctggttaagctcatgaacaaaaga
aatcggctcctaaagccttttcaatatgttgaaaatattggcggcacatcggtcggtcag
aacagatccatacaattgatcaaggtcgggaaaagtgtgctcgtcgtcggtgtaggagag
acgatccagctgctgaaagaaattgaggatgaaaaagagattgaagtcattctcagtcag
catgaagaggcaatgtcaagcaaaatagagtggcaaaagtttgtgaagccgcttaagagt
tctgaacatcagccgcagcaaaaactgccttcattttcaaaagcattaaaagagcaactt
gaagagttaaaacaaaaccgttctgaaggaaagaagaaaggcccacgtcatcatgaatga

DBGET integrated database retrieval system