KEGG   Bacillus subtilis subsp. subtilis 168: BSU16800
Entry
BSU16800          CDS       T00010                                 

Gene name
spoIIIE
Definition
(RefSeq) spore DNA translocase
  KO
K03466  DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU16800 (spoIIIE)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BSU16800 (spoIIIE)
SSDB
Motif
Pfam: FtsK_SpoIIIE FtsK_alpha FtsK_gamma AAA_10 DUF87 FtsK_4TM AAA_19 ATPase_2 T2SSE DUF2075 TrwB_AAD_bind AAA_22 ResIII AAA_7 Ribosomal_S25
Other DBs
NCBI-GeneID: 936503
NCBI-ProteinID: NP_389562
Pasteur: BG10763
BSORF: BG10763
UniProt: P21458
Position
1752272..1754641
AA seq 789 aa
MSVAKKKRKSRKKQAKQLNIKYELNGLLCIAISIIAILQLGVVGQTFIYLFRFFAGEWFI
LCLLGLLVLGVSLFWKKKTPSLLTRRKAGLYCIIASILLLSHVQLFKNLTHKGSIESASV
VRNTWELFLMDMNGSSASPDLGGGMIGALLFAASHFLFASTGSQIMAIVMILIGMILVTG
RSLQETLKKWMSPIGRFIKEQWLAFIDDMKSFKSNMQSSKKTKAPSKKQKPARKKQQMEP
EPPDEEGDYETVSPLIHSEPIISSFSDRNEEEESPVIEKRAEPVSKPLQDIQPETGDQET
VSAPPMTFTELENKDYEMPSLDLLADPKHTGQQADKKNIYENARKLERTFQSFGVKAKVT
QVHLGPAVTKYEVYPDVGVKVSKIVNLSDDLALALAAKDIRIEAPIPGKSAIGIEVPNAE
VAMVSLKEVLESKLNDRPDAKLLIGLGRNISGEAVLAELNKMPHLLVAGATGSGKSVCVN
GIITSILMRAKPHEVKMMMIDPKMVELNVYNGIPHLLAPVVTDPKKASQALKKVVNEMER
RYELFSHTGTRNIEGYNDYIKRANNEEGAKQPELPYIVVIVDELADLMMVASSDVEDSIT
RLSQMARAAGIHLIIATQRPSVDVITGVIKANIPSRIAFSVSSQTDSRTILDMGGAEKLL
GRGDMLFLPVGANKPVRVQGAFLSDDEVEKVVDHVITQQKAQYQEEMIPEETTETHSEVT
DELYDEAVELIVGMQTASVSMLQRRFRIGYTRAARLIDAMEERGVVGPYEGSKPREVLLS
KEKYDELSS
NT seq 2370 nt   +upstreamnt  +downstreamnt
atgagtgtggcaaagaaaaaacgaaaatcaagaaaaaaacaggcgaaacagctcaatata
aaatacgagctcaacggattgctgtgtatagccatttcaattatcgcaatcttgcagctg
ggggtagtcgggcaaacgtttatctatttgttccgcttttttgctggagagtggtttatt
ttatgcttgttaggtttattggtgttaggagtctcactgttttggaagaaaaaaacccca
agccttttaacgagacgaaaggccgggttgtactgtattatcgcaagcatattgctgctt
tctcacgtgcagctatttaaaaatttgacgcacaaagggtctattgagtctgcaagcgtg
gtgcgcaatacgtgggaattgtttttaatggacatgaatggcagctctgcttcacctgat
ttaggcggagggatgatcggtgcgctgctgtttgcggcttcacactttttgtttgcgtcg
actggttctcagatcatggcaattgtcatgattttgatcggaatgattttagtaacagga
cgctcgctgcaagaaacgctaaaaaagtggatgagcccgattggacgttttataaaagaa
caatggttagcatttattgatgacatgaaatccttcaaatcaaatatgcagtcatcgaaa
aaaacgaaagcgccgagcaaaaaacaaaaaccggcccgcaaaaaacagcaaatggaaccg
gagcctcctgatgaagagggggattatgaaacagtatcgcctcttattcattcagagccg
attatctcaagcttttctgatcgtaatgaagaggaagagtctccagttatagaaaagcgc
gccgaacctgtgtcgaagccgcttcaggacatccaaccggagacaggtgatcaggaaact
gtttctgctcctcctatgacctttacagagctcgaaaataaggattacgagatgccgtca
ctggatttgctggcagatccgaagcataccggccagcaggctgataaaaagaatatttat
gaaaatgcgagaaagcttgaacgcacattccaaagctttggcgtaaaggcgaaagtcaca
caggttcatctcggaccggccgtaacaaaatatgaagtatatcctgatgtcggagtgaag
gttagcaaaattgtcaatttaagcgatgatttagcgcttgcgcttgctgcgaaggatatc
aggatcgaagcgcctataccaggcaaatcagcaatcggaattgaagttccaaacgcagaa
gtggcaatggtttcgctgaaagaagtgctggagtctaaattgaatgacagaccggatgcg
aagctgttaattggactcggccgcaatatttcaggtgaagctgtattggctgagttaaac
aagatgccccaccttttggtcgcaggcgcaaccggtagcgggaaaagtgtctgtgtcaac
ggcattattacaagtattttaatgcgggcgaaaccgcatgaagtgaaaatgatgatgatc
gatcctaaaatggtagagctaaatgtctacaacgggattccgcatttgcttgctcctgtt
gtaaccgatccgaaaaaagcgtcgcaggctttgaaaaaggttgtcaatgaaatggagcgg
cggtacgaattattttctcatacgggtacaagaaatattgaaggatacaatgattatata
aaacgcgccaacaatgaagaaggagcgaaacagccagagctgccttatattgttgtcatt
gtggacgagctagccgatctcatgatggtcgcttcatctgatgtggaagattcgattacg
agattgtcccaaatggcgcgggctgccggcatccatcttattattgcgacacagcggcca
tcggtggatgttatcacaggggtgatcaaagcgaacattccgtcacgaatcgcgttcagc
gtatcttcacagacggattcaaggaccattcttgacatgggtggcgctgagaagcttctt
ggccgcggcgatatgctgtttttacctgtaggggctaacaaacctgtccgtgtgcaggga
gcatttttgtcggatgacgaagtggagaaggtcgtcgaccatgtgattactcagcagaaa
gcgcaatatcaagaagaaatgattcctgaggagacgacggaaactcattccgaggttact
gatgaactttatgatgaagctgttgaattaatcgtcggcatgcagacggcatctgtttca
atgctgcaaagaagattcagaattggctatacgagagcggcgcgcctgattgacgcaatg
gaggaacgcggtgttgtcggaccgtatgaaggcagcaaacctagggaagtattattatca
aaagagaaatatgatgagctctcttcttaa

DBGET integrated database retrieval system