KEGG   Bacillus subtilis subsp. subtilis 168: BSU16910
Entry
BSU16910          CDS       T00010                                 

Symbol
ymfM
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_25 DUF4115 HTH_19 Peptidase_S49_N DUF4834 SID-1_RNA_chan Zip Serinc SARAF CIS_TMP DUF6479 V_ATPase_I Neur_chan_memb DUF2254 Herpes_gE Mem_trans MMM1 Tmemb_161AB CLN3 Connexin MAP17 UPF0139 Ly49 O-antigen_lig
Other DBs
NCBI-GeneID: 939591
NCBI-ProteinID: NP_389573
Pasteur: BG13433
BSORF: BG13433
UniProt: O31771
Position
1761707..1762573
AA seq 288 aa
MSLDDLQAATKIQKRYLTALEEGNYDIIPGKFYVRAFIKQYAEAVGLDADQLFEEHKKDI
PNTYHDDVSEKISGMNLQKEMPKPASKALELLPTILVILGVIVVIAIVYAIIQFANHKNS
DDHNAASEKAITQSESKYEIPKDSTLKENQNNSSEKETDTKKETKENEDKKKENDSEKLE
IKAAGTEGSLTTYEVSGADKIELELKASDSSWIRVRDENSSSLKEGTLKKDETYKKDITD
QKQVDIRTGYAPNLKIKINGKVLSYELDPKKVMAQTIKIVNKKEEKSS
NT seq 867 nt   +upstreamnt  +downstreamnt
atgtcattggatgatctccaagcggcaacaaagattcaaaaaaggtatttaaccgccttg
gaggaaggaaactatgacattattccggggaagttttatgttcgggcattcatcaagcaa
tatgcagaagccgttgggcttgatgcggatcagctgtttgaggagcataaaaaagatatc
cctaatacgtatcatgatgatgtgtctgaaaagatctccggcatgaatcttcaaaaggaa
atgccaaagccagcatctaaggcgctggagctgctgccaacaatacttgttattctcggc
gtgattgtcgtgattgccattgtgtacgcgatcattcaatttgccaatcacaaaaacagt
gatgatcacaatgcggcatcagaaaaagcaattacgcaaagtgagagcaagtacgaaatc
cctaaagattcaacgctgaaagagaatcaaaataacagctctgaaaaagagacagacact
aaaaaagaaacgaaagaaaacgaagataagaaaaaagaaaatgacagtgagaagctggag
attaaagctgctggcactgaaggatcgttaacgacttatgaagtgtccggcgctgataaa
atcgagctggaactgaaggcatcagacagctcctggattagagtgcgcgatgaaaacagc
agctctttaaaagaaggaacgctgaaaaaagacgaaacctataaaaaagacataactgat
cagaaacaagttgatatccgcaccggatatgcacctaatctgaaaataaaaatcaacggt
aaggttctttcatatgaacttgatccgaaaaaagtgatggcacaaaccataaagattgta
aataaaaaggaagaaaagtcatcttaa

DBGET integrated database retrieval system