KEGG   Bacillus subtilis subsp. subtilis 168: BSU19390
Entry
BSU19390          CDS       T00010                                 

Gene name
yojN
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: AAA_5 AAA_3 AAA_6 Sigma54_activat AAA_7 Mg_chelatase AAA_14 AAA AAA_16 CbbQ_C T2SSE AAA_2 DEAD TIP49 IstB_IS21 ABC_tran AAA_18 AAA_22 RuvB_N TsaE AAA_30 ResIII RNA_helicase ATP-synt_ab Sigma54_activ_2 CPT AAA_29
Other DBs
NCBI-GeneID: 939458
NCBI-ProteinID: NP_389821
Pasteur: BG13566
BSORF: BG13566
UniProt: O31850
Position
complement(2113764..2114678)
AA seq 304 aa
MNRKGNLSMTTQLQHLTLPEDIQQKLLSYKEQPISPEFQSLIGTSGYEAEDEAILFDAII
ALAMGKNVLLKGPTGSGKTKLAETLSSYFHKPMHSVNCSVDLDAEALVGYKTIENQSGQA
TIEFVSGPVTKAMKEGHFLYIDEINMAKPETLPILNGVLDYRKMMTNPFTGEVIRAKSGF
GVIAAINEGYVGTVPLNEALKNRFVIIDVPYIKGELLKQVLMSQSALKDEKLIDRFITLS
SDLIVQANNGQVSEEAASIRALIDTCDLAAYIPPRRAIERGIVEKLDDDREKAAVRNIAE
TLFE
NT seq 915 nt   +upstreamnt  +downstreamnt
atgaataggaaagggaatctgtctatgacaactcaactacagcacttaacattgccggaa
gatatacaacaaaagcttttatcatataaagagcagcctatttccccagagtttcaatcg
cttataggaacatcaggctatgaggcggaggatgaagccattttatttgacgccattatt
gcattagccatggggaaaaatgtcctgctgaaagggcctacaggttcaggaaaaacaaag
ctggcagaaacattgtccagctattttcataaaccgatgcacagcgtcaactgttcagtc
gacttggacgctgaggcattggtcggttataaaacgattgaaaatcaatctggccaggca
acaatcgagtttgtttcaggacctgttacaaaggcaatgaaggaaggccattttctttat
atagatgaaatcaatatggcgaagccggaaacactgcctattctaaacggtgtattagat
tacagaaaaatgatgacaaatccgtttacaggcgaggtcatacgggctaaaagcggtttc
ggagtcattgcagccatcaatgaaggctatgtcggaactgttcctctgaatgaagcgttg
aaaaaccgttttgtcatcattgatgtgccttatattaaaggcgagctgctgaaacaagtg
ctcatgtctcagtcagccttgaaagacgagaaattgattgacagatttatcacgctttcc
tctgacttgatcgttcaggccaataacggacaggtgtctgaagaagcggcatccatcaga
gctttaatcgatacatgtgatttagctgcttatattccgccgcgtcgtgccattgagcgg
ggaattgtagaaaagcttgatgatgatcgggaaaaagcggctgtccgaaatattgcagaa
actctgtttgaatga

DBGET integrated database retrieval system