KEGG   Bacillus subtilis subsp. subtilis 168: BSU21480
Entry
BSU21480          CDS       T00010                                 

Gene name
sunA
Definition
(RefSeq) bacteriocin sublancin-168
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Sublancin Nup214_FG
Other DBs
NCBI-GeneID: 939121
NCBI-ProteinID: NP_390031
Pasteur: BG12682
BSORF: BG12682
UniProt: P68577 A0A6M4JKE0
Structure
PDB: 
2MIJ

Position
complement(2269521..2269691)
AA seq 56 aa
MEKLFKEVKLEELENQKGSGLGKAQCAALWLQCASGGTIGCGGGAVACQNYRQFCR
NT seq 171 nt   +upstreamnt  +downstreamnt
atggaaaagctatttaaagaagttaaactagaggaactcgaaaaccaaaaaggtagtgga
ttaggaaaagctcagtgtgctgcgttgtggctacaatgtgctagtggcggtacaattggt
tgtggtggcggagctgttgcttgtcaaaactatcgtcaattctgcagataa

DBGET integrated database retrieval system