KEGG   Bacillus subtilis subsp. subtilis 168: BSU22840
Entry
BSU22840          CDS       T00010                                 

Gene name
engA
Definition
(RefSeq) GTPase Der
  KO
K03977  GTPase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU22840 (engA)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  GTPases
   BSU22840 (engA)
SSDB
Motif
Pfam: MMR_HSR1 KH_dom-like FeoB_N GTP_EFTU AIG1 RsgA_GTPase Dynamin_N Roc Ras RNA_helicase ABC_tran Arf PduV-EutP Nuc_deoxyri_tr2 AAA SRPRB cobW AAA_5 DUF1194
Other DBs
NCBI-GeneID: 938988
NCBI-ProteinID: NP_390165
Pasteur: BG11443
BSORF: BG11443
UniProt: P50743 A0A6M3ZGR7
Structure
PDB: 

Position
complement(2390206..2391516)
AA seq 436 aa
MGKPVVAIVGRPNVGKSTIFNRIAGERISIVEDTPGVTRDRIYSSAEWLNYDFNLIDTGG
IDIGDEPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNK
LDNTEMRANIYDFYSLGFGEPYPISGTHGLGLGDLLDAVAEHFKNIPETKYNEEVIQFCL
IGRPNVGKSSLVNAMLGEERVIVSNVAGTTRDAVDTSFTYNQQEFVIVDTAGMRKKGKVY
ETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVVNKWDAVD
KDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLRVQTNVLN
DVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFLENRIRDA
FGFEGTPIKIFARARK
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgggtaaacctgtcgtagccattgtcgggagaccaaatgtaggaaaatccacaatcttt
aaccggattgcgggagaaagaatttcaatagtagaagatacccctggcgtgacaagggat
cggatatacagctcggctgaatggctgaattatgattttaatttgattgatacgggcggt
attgatatcggtgatgagccgtttttagcgcagattcgccagcaagctgaaatcgccatg
gatgaagcggacgtgattatttttatggtgaacggccgtgaaggcgtgacagctgctgat
gaagaagtggcgaaaattttgtaccgcacaaaaaagcctgttgttttagcggttaataaa
ctggataacacagaaatgagagcgaatatttatgatttttattcgctaggctttggcgag
ccgtatccaatttcgggaacacacggactcggactgggtgatttactggatgccgttgca
gagcattttaaaaacattcctgaaacgaaatacaatgaagaagttattcaattctgtctg
atcggacgtccaaatgtcggaaagtcttcacttgtgaatgcgatgctcggcgaagaacgc
gttattgtcagcaacgtggctggaacgacaagagatgctgttgatacgtcatttacttac
aaccagcaggagtttgtcattgtcgatactgcaggtatgcgaaaaaaagggaaagtctat
gaaacgactgagaagtatagtgtactgcgggcgctaaaagcgattgaccgctcagaagtc
gtggcggttgtgctggatggcgaagaaggcattattgaacaggacaagcgtatcgccggt
tatgcacacgaagcgggcaaggccgtcgtcatcgtcgtaaacaaatgggatgctgttgac
aaagatgagagcacgatgaaagaatttgaagaaaatattcgcgatcattttcaatttctg
gattatgcgccaatcctatttatgtctgccttaacgaaaaaacggatccatactctgatg
cctgcgattatcaaagctagtgaaaatcattcacttcgagttcaaacaaacgtcttaaat
gatgtcatcatggacgctgtggcaatgaatccgacaccgactcataacggttctcgtttg
aaaatttactatgcgactcaagtgtcggtaaagccgccaagcttcgttgtgtttgtaaac
gatccggaactgatgcatttttcatacgaacggtttttagaaaaccgaatcagagacgcg
ttcggttttgaggggacaccaatcaaaatatttgcaagagctagaaaataa

DBGET integrated database retrieval system