KEGG   Bacillus subtilis subsp. subtilis 168: BSU23960
Entry
BSU23960          CDS       T00010                                 

Symbol
artR
Name
(RefSeq) arginine transport ATP-binding protein ArtM
  KO
K23060  arginine/lysine/histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU23960 (artR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU23960 (artR)
Enzymes [BR:bsu01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     BSU23960 (artR)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Arginine/lysine/histidine transporter
    BSU23960 (artR)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_16 ABC_ATPase AAA_29 AAA_13 AAA_22 AAA_33 RsgA_GTPase AAA_23 AAA_25 T2SSE G-alpha AAA_24 AAA_30 IIGP SbcC_Walker_B Mg_chelatase DUF87 AAA_18 CobU DEAD PRK ATP_bind_1 NACHT DUF5906 FtsK_SpoIIIE MMR_HSR1
Other DBs
NCBI-GeneID: 938686
NCBI-ProteinID: NP_390276
Pasteur: BG11729
BSORF: BG11729
UniProt: P54537 A0A6M4JL58
Position
complement(2490574..2491296)
AA seq 240 aa
MIKVEKLSKSFGKHEVLKNISTTIAEGEVVAVIGPSGSGKSTFLRCLNLLEKPNGGTITI
KDTEITKPKTNTLKVRENIGMVFQHFHLFPHKTVLENIMYAPVNVKKESKQAAQEKAEDL
LRKVGLFEKRNDYPNRLSGGQKQRVAIARALAMNPDIMLFDEPTSALDPEMVKEVLQVMK
ELVETGMTMVIVTHEMGFAKEVADRVLFMDQGMIVEDGNPKEFFMSPKSKRAQDFLEKIL
NT seq 723 nt   +upstreamnt  +downstreamnt
atgattaaggttgaaaagctgtcaaaatcatttgggaaacacgaagtattaaaaaacatt
tcaacaacaatcgctgagggtgaggttgttgccgtgatcggtccttcaggctcaggcaaa
tcaacgttcttacgctgtttaaacctgttggaaaagcctaacggcggaaccattacaata
aaagacacagagattacgaagccgaaaaccaacacattaaaggtccgggaaaacatcggg
atggtttttcagcattttcatctctttccgcacaaaacggttctcgaaaacatcatgtac
gcgcctgtcaatgtaaaaaaagaatcaaaacaggctgcacaggagaaagctgaggacctg
ctccgcaaagtcggtttgtttgaaaagcgaaatgactatccaaaccgtttgtctggcgga
caaaaacagcgtgtcgcgattgccagggctcttgcgatgaatccggacatcatgctgttt
gacgagccgacctccgcccttgatccagagatggtcaaagaagtgctacaggtgatgaaa
gagctggtcgaaaccggcatgaccatggtgattgtcacacatgaaatgggcttcgcaaaa
gaagtggcagaccgtgtgctgtttatggaccaaggaatgattgtcgaagacggcaatccg
aaggaattttttatgtcgccaaaatccaaaagagcgcaggactttttagagaaaatatta
tag

DBGET integrated database retrieval system