KEGG   Bacillus subtilis subsp. subtilis 168: BSU25140Help
Entry
BSU25140          CDS       T00010                                 

Gene name
cshB
Definition
(RefSeq) DEAD/DEAH box helicase
  KO
K18692  ATP-dependent RNA helicase CshB [EC:3.6.4.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bsu03019]
    BSU25140 (cshB)
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU25140 (cshB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     BSU25140 (cshB)
Messenger RNA biogenesis [BR:bsu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     BSU25140 (cshB)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic Type
  rRNA helicases
   BSU25140 (cshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C ResIII Helicase_RecD CMS1 AAA_22 PhoH
Motif
Other DBs
NCBI-GeneID: 937908
NCBI-ProteinID: NP_390393
Pasteur: BG11664
BSORF: BG11664
UniProt: P54475
Position
complement(2594184..2595500)
Genome map
AA seq 438 aa AA seqDB search
MKETKFELYELKPFIIDAVHRLGFYEPTDIQKRLIPAVLKKESVIGQSQTGTGKTHAYLL
PLLNKIDPAKDVVQVVITAPTRELANQIYQEALKITQGEEGSQIRSKCFIGGTDKQKSID
KLKIQPHLVVGTPGRIADLIKEQALSVHKAESLVIDEADLMLDMGFLADVDYIGSRMPED
LQMLVFSATIPEKLKPFLKKYMENPKYAHVEPKQVTAAKIEHILIPSKHRDKDKLLFDIM
SHLNPYLGIVFANTKNTADHIAQYLTGKGMKIGLLHGGLTPRERKKVMKQINDLEFTYII
ATDLAARGIDIKGVSHVINYELPDDLDFYVHRVGRTARAGSSGQAMTIYELTDEDALVRL
EKMGIEFEYLELEKGEWKKGDDRQRRKKRKKTPNEADEIAHRLVKKPKKVKPGYKKKMSY
EMEKIKKKQRRNQSKKRK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaacgaaatttgaactttatgaattgaaaccatttattatagatgcagtacat
cgccttggtttttacgaaccgactgatatccagaaaaggctgattcctgcagtgttaaaa
aaagaaagcgtcatcggccagtctcagacgggtactggaaagactcacgcttatttactg
cctttattaaacaaaatcgatcctgctaaggatgtcgttcaggtagtcattacggctccg
acaagagagcttgccaaccagatttatcaggaagcgcttaaaatcacgcagggtgaagaa
ggaagtcagattcgctcgaaatgttttatcggaggcactgataaacaaaaatcaattgat
aaattgaaaatacagccgcatcttgttgtcggtacacctggacggattgctgacttaatc
aaagaacaggcgttaagtgttcataaagcggaatctcttgttattgatgaagcggattta
atgctggacatgggattccttgcagatgtagattacatcggttcccgcatgcctgaggat
ctgcaaatgcttgtgttctcagcgaccataccggaaaagctgaaaccattcttgaagaaa
tacatggaaaatccgaaatacgcccatgtggagccaaaacaggtgactgctgcgaaaatc
gagcatatcctcattccttcgaaacatcgtgacaaggacaagctcctttttgacatcatg
tcgcatctgaatccatacctggggattgtgtttgccaacacgaaaaatacggctgaccat
attgcccagtatctgactggcaaaggcatgaaaatcggcttgctgcacggcggattaaca
ccacgtgagcggaaaaaagtcatgaagcagatcaatgatttggaattcacatatatcatt
gcaactgaccttgccgcaagaggtattgatattaaaggtgtcagccatgttatcaactat
gagctgccggatgatctcgatttctatgttcaccgtgtgggcagaacggctcgtgccggc
tcatcaggacaagcgatgaccatttatgagcttactgatgaggatgcattagtaagactt
gaaaaaatgggcatcgaatttgagtacttagagcttgaaaagggcgaatggaaaaaaggc
gatgaccgtcagcgccgcaaaaaacgtaaaaaaacgccgaatgaagcggatgaaattgct
catcgtctcgtgaaaaagccgaagaaggttaagcctgggtataaaaagaaaatgagctat
gagatggagaaaatcaagaaaaaacagagaagaaaccaatctaagaaaagaaagtag

DBGET integrated database retrieval system