KEGG   Bacillus subtilis subsp. subtilis 168: BSU25670
Entry
BSU25670          CDS       T00010                                 

Symbol
yqeH
Name
(RefSeq) hypothetical protein
  KO
K06948  30S ribosome assembly GTPase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU25670 (yqeH)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  GTPases
   BSU25670 (yqeH)
SSDB
Motif
Pfam: MMR_HSR1 RsgA_GTPase FeoB_N Roc Dynamin_N Ras MeaB ABC_tran Xre_MbcA_ParS_C RNA_helicase AAA_7 AIG1
Other DBs
NCBI-GeneID: 937822
NCBI-ProteinID: NP_390445
Pasteur: BG11636
BSORF: BG11636
UniProt: P54453 A0A6M3ZEB8
Position
complement(2645490..2646590)
AA seq 366 aa
MEKVVCIGCGVTIQTEDKTGLGYAPPASLTKENVICQRCFRLKNYNEIQDVSLTDDDFLN
ILHGIGETDSLVVKIVDIFDFNGSWINGLQRLVGGNPILLVGNKADILPKSLKRERLIQW
MKREAKELGLKPVDVFLVSAGRGQGIREVIDAIEHYRNGKDVYVVGCTNVGKSTFINRII
KEVSGEEDIITTSQFPGTTLDAIEIPLDDGSSLYDTPGIINNHQMAHYVNKKDLKILSPK
KELKPRTFQLNDQQTLYFGGLARFDYVSGERSPFICYMPNELMIHRTKLENADALYEKHA
GELLTPPGKDEMDEFPELVAHTFTIKDKKTDIVFSGLGWVTVHDADKKVTAYAPKGVHVF
VRRSLI
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggaaaaggttgtttgtatcgggtgcggagttacgatccaaaccgaggacaaaacaggt
ttggggtacgcgccgcctgcatcgcttacgaaagaaaatgtgatttgccagcgttgcttc
agactgaaaaactataatgaaatacaagatgtctccttaactgatgatgattttttgaac
attcttcacggtattggagaaacggactctctggtcgtaaaaattgttgatatttttgat
tttaacggcagctggattaatgggctgcagcgcttggtggggggaaaccctatcttatta
gttggcaataaagcggatattttgcctaagtcactgaaaagagagcgtctgatccaatgg
atgaagcgtgaagcgaaagagcttggcttaaaaccggttgacgtatttttggtcagtgcg
ggtcgcggccagggaatcagagaagtaattgacgcgattgagcattaccgcaacggaaaa
gacgtctatgttgtcggatgtacaaatgtaggaaagtcaacctttattaaccggattatt
aaagaagtgtcaggtgaagaagatattattacaacatcccaatttcctggcacaaccctt
gatgcgattgaaatcccgctggatgacggttcatcgctttatgatacaccgggaattatc
aacaaccatcaaatggcgcattatgtcaataaaaaggacctgaaaatattatctcctaaa
aaggagctgaagcctcgcacattccagcttaatgatcagcaaacactgtattttggcgga
cttgcaaggtttgattatgtgtctggggaaagatctccttttatttgctatatgccgaat
gagctgatgattcatagaacaaaacttgaaaatgcagacgcgctttatgaaaagcatgca
ggggaattgctcacacctccgggtaaagatgaaatggatgagtttcctgaattggtcgcc
catacgtttacgataaaagacaaaaagacagatatcgttttctctgggttaggctgggtt
actgtccatgacgctgataaaaaggtaactgcatacgcgccaaaaggcgttcatgtattt
gttcggcgttcattaatttaa

DBGET integrated database retrieval system