KEGG   Bacillus subtilis subsp. subtilis 168: BSU27080Help
Entry
BSU27080          CDS       T00010                                 

Gene name
levR
Definition
(RefSeq) transcriptional regulatory protein LevR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_activat PRD EIIA-man AAA AAA_5 Mg_chelatase AAA_2 Sigma54_activ_2 AAA_22 RuvB_N TrmB AAA_16 BLYB AAA_7 AAA_29 DUF87 NACHT FtsK_SpoIIIE T2SSE GerE
Motif
Other DBs
NCBI-GeneID: 937594
NCBI-ProteinID: NP_390586
Pasteur: BG10677
BSORF: BG10677
UniProt: P23914
Position
complement(2763025..2765832)
Genome map
AA seq 935 aa AA seqDB search
MRRIDKIYHQLKHNFHDSTLDHLLKIQGNSAKEIAEQLKMERSNVSFELNNLVRSKKVIK
IKTFPVRYIPVEIAEKLFNKKWDTEMMEVKDLQAFSGNSKQNHQHISTNPLELMIGAKGS
LKKAISQAKAAVFYPPNGLHMLLLGPTGSGKSLFANRIYQFAIYSDILKAGAPFITFNCA
DYYNNPQLLLSQLFGHKKGSFTGAAEDKAGLVEQANGGILFMDEIHRLPPEGQEMLFYFI
DSGSYNRLGESEHKRTSNVLFICATTENPSSALLKTFLRRIPMTIHIPSLEERSLNERVD
LTTFLLGKEAERIKKNLSVHIDVYNALIHSAKFGNVGQLKSNVQLVCAHGFLHNLDRNEV
IELTVRDLPDEIKQEWMSSSKNMQRSKAISEYVNITTIISPIVEDETTKIDEDLSFNLYH
LIEEKVKTLMKEGLSKKDINQYILTDVHLHVRSFFHHQAFQKDNLLTFVEDDVIQMTKQL
KEIAEHELDCTFDRKFIYFLSMHIDAFLKRGKQIDVLNTQETDEIRDTHVKEYRVAMIFK
DKIQEYFKVAIPEIEVIYLTMLIHSIKSLKENKRVGIIVAAHGNSTASSMVEVATELLGS
TPIAAVDMPLTVSPSDILECVAEKMKQVDEGEGVLMLVDMGSLAMLESRLEEKTGISIKT
ISNVTTSMVLDAVRKVNYLNLNLHAIYQSVTKDFIELWERQPAASGKKKALVSICTTGSG
TAKKLEDILTTIVNKASDTPIHILTVSSIKLANSIKEIEKEYEILATVGTKDPKINAPHV
SLEVLIEGEGEKLIQQAITKGSISLSNGLNEANIIVRELCEDSLKKYLVFLNPHHVIDML
LEWLQTVQDELGVIFNNAVLIKVIMHTAFAFERVIKQNPIAFSEEEEINDQLKEMVYVTE
RTLAPYEEKLGLRISDDEKLFIAAIFAEEVHGQLF
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
gtgagaagaatagataaaatataccatcagctcaagcataattttcatgattcaacctta
gatcatcttttaaaaatacaagggaattcagcaaaggagattgccgagcagctgaaaatg
gagcggtccaatgtcagctttgaattgaacaatctcgtccggtccaaaaaggtcatcaaa
attaaaacatttcctgtaagatacatcccagtcgagatagcagaaaaattattcaacaag
aaatgggatacagagatgatggaagtgaaagaccttcaggcgttttccggaaattcaaag
caaaatcatcaacacatttccacgaatcccctagagcttatgataggggcaaaagggagt
ttgaagaaagcgatctcccaggcaaaagcagctgtcttttatccgccgaacggtctgcat
atgctcctcctagggccgactggttccggtaaatccctttttgcgaaccgaatttaccag
tttgccatttactctgacatattgaaggccggcgcaccatttattacatttaactgtgca
gactactacaacaaccctcaattattgctttctcaattattcggacacaaaaaaggttca
tttacaggtgctgccgaggataaggcgggtttagtcgaacaggccaatgggggcattctt
tttatggatgaaatccaccgtctccctcccgagggacaagaaatgctgttttattttatt
gacagcggttcttataacaggcttggagaatctgaacataaacgaacatcgaacgtattg
tttatttgtgcgactacagaaaatccgagttctgcactattgaaaacgtttttgcgaaga
atcccaatgaccattcatattccttcgcttgaagaacgatcgcttaatgaaagagtggat
ctgacgacgtttttattagggaaagaagcagagcgaattaagaagaatctgagtgtgcat
atcgatgtctataatgcgcttattcactctgcgaaatttgggaatgtcggacagctgaaa
tcaaatgttcagttagtttgcgcacacggatttttgcataaccttgacagaaatgaagtt
attgaactgactgttcgcgatctgcctgatgaaatcaagcaagaatggatgtccagcagc
aaaaacatgcaaagaagcaaagccatttctgaatatgtcaatattacaacgattatctct
ccgattgtagaagatgaaacaacaaaaattgacgaagacctctcatttaacttatatcat
ttgattgaggaaaaagtgaaaacgcttatgaaagaaggtttatccaaaaaggatattaac
cagtacatcttgactgatgtccatttgcatgtcagaagtttttttcatcatcaagctttt
caaaaagacaacctgctgacattcgttgaagacgatgtgattcaaatgacaaaacagtta
aaagaaatagctgaacatgagctggattgcacatttgaccgtaagtttatttatttcttg
agtatgcatattgacgcatttttaaagcgaggaaagcaaattgatgttttgaatacacag
gagacagatgaaattcgtgatacccatgtgaaagaatatcgggtggcgatgatttttaaa
gataaaattcaggaatattttaaagtggctattcctgaaatagaagtcatctacttaacg
atgttaattcattccatcaaatcgttaaaggagaacaaaagagtcggtattatcgtggca
gctcatggaaacagcacggcgagttcaatggttgaagtcgcgacagaactgctagggagt
acgccgattgcagcagttgacatgccgcttactgtttcaccttcggacattcttgaatgc
gtagcagaaaaaatgaaacaggttgatgaaggtgaaggtgttttaatgctggtagatatg
gggtcgcttgcaatgctggaaagcaggctggaggaaaagacaggcatttctattaaaacg
atcagcaatgttacgacttcaatggtgctggatgctgtcagaaaggtcaactatttgaat
ttaaatttgcatgcgatctatcaatcggtcacgaaggattttatcgagttgtgggagcgt
cagccagcggcatccggcaaaaagaaggcattggtatccatctgcacgacgggtagcgga
acggccaaaaagctggaagacattctaaccacgatcgtaaacaaggcctccgataccccc
attcacatattgaccgtatcatcgattaagctggccaacagcataaaagaaatcgaaaaa
gagtatgaaatccttgcgacagtcggaacgaaagaccctaaaatcaatgctccgcatgta
tctttagaagtgttaattgaaggggagggagagaagctgattcaacaggcgattacaaaa
ggaagcatctccttgagcaatggattgaacgaagcaaatattattgtcagggagctttgc
gaggatagcctgaaaaaataccttgtcttcttgaatccccaccatgtgatcgacatgtta
ttggagtggctgcaaaccgttcaggatgagctgggggtcattttcaataatgcggttttg
atcaaagtcattatgcacacggctttcgcctttgaaagggtaattaagcagaatccgatc
gctttctcagaggaagaagagatcaatgatcagctgaaggaaatggtgtacgtgacagag
cgaacattagccccttatgaagaaaagctcggacttcgcataagtgatgatgaaaaatta
tttatagccgccatatttgctgaagaagtgcatggccagctgttttaa

DBGET integrated database retrieval system