KEGG   Bacillus subtilis subsp. subtilis 168: BSU27300
Entry
BSU27300          CDS       T00010                                 

Symbol
yrrS
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1510 Neur_chan_memb SpoIIIAH V_ATPase_I O-antigen_lig DUF6377 Zip Nop14 SID-1_RNA_chan Cwf_Cwc_15 CSG2 MAP17 SLC12 Apt1 NPR3 ODV-E18 Macoilin Serinc DUF6040
Other DBs
NCBI-GeneID: 936614
NCBI-ProteinID: NP_390608
Pasteur: BG13798
BSORF: BG13798
UniProt: O32031 A0A6M3ZET9
Position
complement(2788920..2789621)
AA seq 233 aa
MSNNQSRYENRDKRRKANLVLNILIAIVSILIVVVAANLFINSPSSKDVSKDSETAQKQE
SPASGKTEKKSDEDIKDSKKDTSDSEKDSEKSSDSDSKKDDSSSKKDDSDSDSSSDSAGD
GLKDAKVTEGGSSSDVEKTYENPDWKAVGTEQTGEHAATYDSSSQDWAEMLKAISYATGV
STDNMTVLWLGNNGSPQDAKGKILDKATGNKYQVTITWVDEKGWKPTKVEKLK
NT seq 702 nt   +upstreamnt  +downstreamnt
ttgagcaataatcaatctcgttatgaaaatcgtgataaacgcagaaaagccaatttagtg
cttaacattttaatcgcaatcgtatccatactaattgtcgtagtagcagcgaatctcttc
attaacagtccttctagcaaagatgtcagcaaggattctgaaacggcgcaaaaacaggaa
tctccggcttcaggaaagacggaaaagaaatcggatgaggatataaaagacagcaagaaa
gatacatctgacagcgaaaaggattctgagaagtcttctgactctgattccaaaaaagat
gattcttcttctaaaaaagatgactctgattcagattcaagctcagattcagccggtgac
gggcttaaagatgcaaaagtaacagaaggcggctcatcgagcgatgtggaaaaaacgtat
gaaaatcctgactggaaagcagtcggaactgagcagactggcgagcatgccgctacttat
gattcaagctcacaagactgggctgagatgctgaaagccatttcgtacgcaactggtgtc
tcaacagataacatgacggtgctctggcttggaaataacggcagccctcaggatgccaaa
ggcaagattttggacaaggcgactgggaataaatatcaagtcacgattacatgggtcgat
gaaaaaggctggaagccgacaaaagtagaaaagctaaaataa

DBGET integrated database retrieval system