KEGG   Bacillus subtilis subsp. subtilis 168: BSU27300Help
Entry
BSU27300          CDS       T00010                                 

Gene name
yrrS
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1510 Neur_chan_memb SpoIIIAH V_ATPase_I SID-1_RNA_chan Zip Nop14 O-antigen_lig Cwf_Cwc_15 DUF4834 CSG2 SLC12 CDC45 ODV-E18 Apt1 MAP17 Macoilin Serinc NPR3 SAPS
Motif
Other DBs
NCBI-GeneID: 936614
NCBI-ProteinID: NP_390608
Pasteur: BG13798
BSORF: BG13798
UniProt: O32031
Position
complement(2788920..2789621)
Genome map
AA seq 233 aa AA seqDB search
MSNNQSRYENRDKRRKANLVLNILIAIVSILIVVVAANLFINSPSSKDVSKDSETAQKQE
SPASGKTEKKSDEDIKDSKKDTSDSEKDSEKSSDSDSKKDDSSSKKDDSDSDSSSDSAGD
GLKDAKVTEGGSSSDVEKTYENPDWKAVGTEQTGEHAATYDSSSQDWAEMLKAISYATGV
STDNMTVLWLGNNGSPQDAKGKILDKATGNKYQVTITWVDEKGWKPTKVEKLK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
ttgagcaataatcaatctcgttatgaaaatcgtgataaacgcagaaaagccaatttagtg
cttaacattttaatcgcaatcgtatccatactaattgtcgtagtagcagcgaatctcttc
attaacagtccttctagcaaagatgtcagcaaggattctgaaacggcgcaaaaacaggaa
tctccggcttcaggaaagacggaaaagaaatcggatgaggatataaaagacagcaagaaa
gatacatctgacagcgaaaaggattctgagaagtcttctgactctgattccaaaaaagat
gattcttcttctaaaaaagatgactctgattcagattcaagctcagattcagccggtgac
gggcttaaagatgcaaaagtaacagaaggcggctcatcgagcgatgtggaaaaaacgtat
gaaaatcctgactggaaagcagtcggaactgagcagactggcgagcatgccgctacttat
gattcaagctcacaagactgggctgagatgctgaaagccatttcgtacgcaactggtgtc
tcaacagataacatgacggtgctctggcttggaaataacggcagccctcaggatgccaaa
ggcaagattttggacaaggcgactgggaataaatatcaagtcacgattacatgggtcgat
gaaaaaggctggaagccgacaaaagtagaaaagctaaaataa

DBGET integrated database retrieval system