KEGG   Bacillus subtilis subsp. subtilis 168: BSU28220Help
Entry
BSU28220          CDS       T00010                                 

Gene name
clpX
Definition
(RefSeq) ATP-dependent Clp protease ATP-binding subunit ClpX
  KO
K03544  ATP-dependent Clp protease ATP-binding subunit ClpX
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsu03110]
    BSU28220 (clpX)
Chaperones and folding catalysts [BR:bsu03110]
 Heat shock proteins
  HSP100
   BSU28220 (clpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_2 zf-C4_ClpX ClpB_D2-small AAA AAA_5 AAA_22 RuvB_N MCM Mg_chelatase Sigma54_activat Sigma54_activ_2 AAA_14 AAA_16 AAA_18 ABC_tran TsaE IstB_IS21 AAA_7 T2SSE NACHT PhoH TIP49 AAA_21 AAA_24 RNA_helicase C1_2 DEAD
Motif
Other DBs
NCBI-GeneID: 937482
NCBI-ProteinID: NP_390700
Pasteur: BG11387
BSORF: BG11387
UniProt: P50866
Position
complement(2884781..2886043)
Genome map
AA seq 420 aa AA seqDB search
MFKFNEEKGQLKCSFCGKTQDQVRKLVAGPGVYICDECIELCTEIVEEELGTEEEVEFKD
VPKPQEIREILNEYVIGQDQAKKSLAVAVYNHYKRINSNSKVDDVELSKSNISLIGPTGS
GKTLLAQTLARILNVPFAIADATSLTEAGYVGEDVENILLKLIQAADYDVEKAEKGIIYI
DEIDKVARKSENPSITRDVSGEGVQQALLKILEGTVASVPPQGGRKHPHQEFIQIDTTNI
LFICGGAFDGIEQIIKRRLGQKVIGFGADNKAADLEKEDLLSKVLPEDLLRFGLIPEFIG
RLPVIASLEKLDEEALVAILTKPKNALVKQFKKMLELDNVELEFEEEALSEIAKKAIERK
TGARGLRSIIEGIMLDVMFELPSRDDIEKCVITGATVTHGEPPRLLLKDGTEVSQDKTSA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaatttaacgaggaaaaaggacaattaaaatgctcgttctgtggaaaaacacaa
gatcaggttcgtaagcttgtagctggacctggtgtatatatatgtgacgaatgtatcgaa
ctctgcactgaaattgtagaggaagaactcggaacagaagaagaagtagaatttaaagac
gtaccaaagcctcaggaaattcgcgaaattttgaatgaatatgtcatcggccaagatcaa
gcgaagaaatcacttgctgttgctgtgtataaccactataagcgcattaactccaacagc
aaagttgatgatgttgagctttcaaaaagtaatatttcattaatcggccctacgggaagc
ggtaaaacccttctggcgcaaacattggctcgcattttaaatgtgccgtttgcgattgcg
gacgctacatctttgactgaagctggatacgtgggtgaagatgtagagaatattctcttg
aagctcatccaagctgctgattatgatgtggaaaaagccgaaaaaggcattatctatatt
gatgaaatcgataaagtggctagaaaatctgaaaacccgtctatcacacgtgatgtgtca
ggtgagggtgtacagcaggcattgcttaaaattcttgagggtacagtggcaagcgtaccg
cctcaaggtggacgtaagcatcctcatcaagaattcattcaaattgacacaacaaatatt
ttgttcatttgcggcggagctttcgatggtatcgaacaaatcatcaaacgccgtttaggc
caaaaagtgattggattcggtgccgacaataaagctgctgatcttgagaaagaagatctt
ctttcaaaagtgcttccagaagatttgctccgtttcgggttaattcctgaatttatcgga
cgtcttccggttattgcaagccttgaaaagcttgacgaagaagcattggttgcgatctta
acaaaaccgaaaaacgctcttgttaagcaattcaagaaaatgcttgagcttgacaacgtt
gagcttgagtttgaagaagaagcgctttctgaaattgctaaaaaagcaattgaacgcaag
actggagcacgcggactccgttctatcattgaaggcatcatgcttgatgtgatgtttgag
ctgccttctcgtgatgacattgaaaaatgtgtaatcaccggggcaactgtgacacacgga
gagcctcctcgcctcttattaaaagacggcactgaggtaagccaagataaaacatctgca
taa

DBGET integrated database retrieval system