KEGG   Bacillus subtilis subsp. subtilis 168: BSU29805
Entry
BSU29805          CDS       T00010                                 

Symbol
ytpS
Name
(RefSeq) DNA translocase SftA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: FtsK_SpoIIIE FtsK_alpha FtsK_gamma DUF87 AAA_10 AAA_22 DUF853 ResIII DEAD P-loop_TraG AAA_29 Adeno_IVa2
Other DBs
NCBI-GeneID: 938522
NCBI-ProteinID: NP_390859
UniProt: C0SP86 A0A6M4JMP9
Position
complement(3049725..3052583)
AA seq 952 aa
MSWLHKFFDLFLGESEEDAERETKPAQIPQQQEVHHPEGQLKRLEDPKIYYEYPKGKFRF
PVVPDGYKNHDLRRRRTPSDEPKSAPRPSAAPYRERPRNEEEQHTYQAAEPAKKPFKPTN
IPSPVYGFNQKPSVKKDVPKKPSETLNEPDKSVKEKVTLLSEEIERERGYPASDTQAHSK
IESPFFPDTQFEKQPSGVLNRKDTEHDEALAKRPAEPSGNKVPFESGVQQPEKEEPFFPA
EQAEEQTPPEMLTDTAAEGLSDSEVGREEPATAEEEQREQQPEKFEEPVFSAELDEEQTA
PESQTEAVSEDEKAKEPSDSPVYNHHENAAEGAESPFVQEEQMDIRQEEPLFTDHEYSSE
ALAQAETVAKESEEPSESIINNHYDTLGEAQETKIDVQPDSHTELEKTEHMEQGSKSSTA
TLENRQEIRADKPREASEEPKKRPGVQEKRTEQSASSQKGPSVPFNVMMLKRDTHKQQKA
EERRGSYVFPNVALLDVPPAQVQDDTAWIEEQRQLLDLTLKNFNVRANVVHVTQGPSVTR
FEVHPEPGVKVNKITNLSDDIKLSLSAKDIRIEAPIPGKNTIGIEVPNRTSKVVDLRQMI
RSSAFRTSKSPLTAALGLDISGNPVVIDLKKMPHGLIAGATGSGKSVCINTILVSLLYKA
DPSEVKVLLIDPKMVELAPYNKIPHLVSPVITDAKAATAALKWVVEEMERRYELFAHSGV
RDIDRFNQLTAEHQMGEKLPYLVVIIDELADLMMVAPNDVEESIARIAQKARACGIHLLV
ATQRPSVDVITGLIKANIPTRIAFSVSSQVDSRTIIDIAGAEKLLGKGDMLFLENGSGKP
VRLQGNFVSDREIDRVVSHVRSQMPPTYLFEQEELVRQGSALKEEDELFYEACEFVVEQN
SASTSSLQRRFRIGYNRAARLIDMMEAEGMISEAKGSKPREVLITASDLINE
NT seq 2859 nt   +upstreamnt  +downstreamnt
atgagttggcttcataaattttttgatttgtttttaggcgaaagcgaagaggatgctgaa
cgggagacaaaacccgctcaaattccgcagcaacaagaagtacatcatcctgaaggacaa
ttaaaaagattggaagatcctaaaatatattatgaatatccaaaaggcaaattccgtttt
ccagtcgtgcctgacggatacaaaaatcatgacctgagaaggcgccgcacaccatcggac
gaaccgaaatccgcgcctcgtccaagtgctgcaccttacagagagcgtcccagaaatgaa
gaagagcagcatacatatcaagcagcagagccggcgaagaaaccgtttaaaccgacaaat
atcccttcgcctgtctatggattcaatcaaaaaccatctgttaaaaaggatgtgccgaaa
aagccttctgaaacattgaacgaaccggataaatcggtaaaagagaaggtaacactgctg
tcagaagagatcgaacgtgaacgcggctatcctgcttcagacacacaggcgcattccaaa
atagaaagtcctttcttcccggatacccaatttgaaaaacagccttctggcgttttaaac
agaaaggatacggagcatgatgaggcgctggcgaaacggccagccgagccgtcaggtaac
aaagtgccatttgagtcaggcgttcaacagccggaaaaagaggagcctttcttcccagct
gaacaagccgaagagcaaacaccgcctgagatgctcacagatacggcggctgaagggctt
tcagacagtgaagtaggccgcgaagagcctgcaacggctgaggaagaacaaagggagcag
cagccagagaaatttgaagagcctgttttctccgctgaacttgatgaagagcaaacagct
cctgaatctcagacagaggcagtatctgaggatgaaaaagcaaaagagccgtcagacagc
ccagtatacaatcatcatgaaaacgcggcagaaggtgctgagtccccgttcgttcaagaa
gaacaaatggacattcgtcaggaagagcctttatttactgatcatgagtattcatcagag
gctctggctcaagcagaaactgtggcaaaagaatcagaagagccatcagaaagcataata
aataatcattatgacaccctgggagaggctcaggaaacgaagatagatgttcagccagac
agccatacagagcttgagaaaactgaacacatggagcagggttccaaatcgtctactgca
actcttgaaaaccggcaggaaattcgcgcagacaaacctcgcgaagcttcagaagagccg
aaaaaaaggcctggtgtacaggagaaaaggactgaacaaagcgcatcttctcaaaaaggg
ccatccgttccttttaatgtgatgatgctgaaaagagatacgcataaacagcaaaaagca
gaggagcgccgcggcagctatgtatttccgaatgttgcactgcttgatgtcccgccagcg
caggttcaagatgatactgcgtggatcgaagaacagcgtcagcttcttgatttgaccttg
aaaaatttcaatgtccgcgccaatgtggtccatgtaacccagggtccgtctgtcacgaga
tttgaagtgcatcctgaaccgggtgtaaaggtgaataaaatcaccaacttgtccgatgat
attaaactcagtctctcagctaaagatattcggattgaagcgccgattccggggaaaaac
acgatcggaattgaagtgccgaaccgcacgagcaaggtggttgatttgcgccaaatgatt
cgcagctcagctttcaggacaagcaagtcaccgctcacagctgcgctgggattagatatt
tcgggaaatcctgttgttatcgacttgaagaaaatgccgcatggcttgattgccggcgct
acaggctccggaaaaagcgtatgcatcaatacaatattagtaagcctgctttataaagct
gacccgagtgaggtaaaggtgctgctgattgatccgaaaatggtagagctggccccttac
aataaaattcctcacctcgtcagcccggtcattactgatgctaaagcggctacggctgct
ttgaaatgggtcgttgaggaaatggagcgccgctatgagctttttgcccattcaggtgtc
cgcgacattgaccgctttaatcaattaaccgctgaacaccaaatgggtgaaaagctgccg
tatttagttgtcattattgatgagcttgcagatttgatgatggtggctccaaacgatgtg
gaagaaagcattgcgcggatcgcccaaaaagccagagcgtgcggtatccatcttctcgtc
gcaactcagcgtccgtcagtcgatgtcattacaggtctgattaaggcgaatatcccaacg
agaatcgccttttctgtctcaagccaggttgattcccgaacaattattgatatagccggt
gcagaaaagcttctcggaaaaggggatatgctctttttggaaaacggctcgggaaaaccg
gttcgtctgcaaggtaactttgtgtcagaccgggaaatcgaccgcgtcgtttcccacgtc
agaagccaaatgccgccgacctatttatttgaacaagaagagctcgtaagacaaggatct
gccctgaaagaagaggacgaactgttttacgaagcgtgtgagtttgttgtagagcaaaac
agtgcgagcacttcaagcctgcaaagaagattcagaatcggttacaatcgtgcggcaagg
ctgatcgacatgatggaagcggaaggcatgatctctgaggcaaaaggaagcaagcctcga
gaggtgctgatcacagcaagtgatttaataaacgaataa

DBGET integrated database retrieval system