KEGG   Bacillus subtilis subsp. subtilis 168: BSU30450
Entry
BSU30450          CDS       T00010                                 

Symbol
ytrB
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K16921  acetoin utilization transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU30450 (ytrB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU30450 (ytrB)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Acetoin utilization transporter
    BSU30450 (ytrB)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_23 AAA_16 AAA_30 AAA_29 Gtr1_RagA G-alpha RNA_helicase DUF87 SbcCD_C AAA_15
Other DBs
NCBI-GeneID: 936641
NCBI-ProteinID: NP_390923
Pasteur: BG13912
BSORF: BG13912
UniProt: O34641 A0A6M3ZFT1
Position
complement(3117976..3118854)
AA seq 292 aa
MIELRQLSKAIDGNQVLKDVSLTIEKGEIFGLLGRNGSGKTTMLRLIQQIIFADSGTILF
DGVEIKKHPKVKQNIIYMPVQNPFYDKYTYKQLVDILRRIYPKFDVTYANELMNRYEIPE
TKKYRELSTGLKKQLSLVLSFAARPALILLDEPTDGIDAVTRHDVLQLMVDEVAERDTSI
LITSHRLEDIERMCNRIGFLEDNSLTNVMDLDELKEEYIKIQMAFDTDVNLAIREQNIPM
LDQAGVFYTVLIPKSDEEKKSFLRELKPKVWNELPVNLEEVFIAKFGGKRRW
NT seq 879 nt   +upstreamnt  +downstreamnt
atgattgaactgcggcagctgtcaaaagcgattgacggcaatcaagtattaaaagatgtt
tcattaacaatcgaaaaaggagaaatctttggattgcttggacgcaatggatcgggcaaa
acgacgatgcttcgcttaatccagcaaatcattttcgctgacagcggaacgattttattt
gacggcgtagaaatcaaaaagcacccgaaagtcaaacaaaatatcatctacatgcctgtt
caaaatccgttttacgataagtatacatacaagcagttagtcgatattttgagaagaata
tatccgaaatttgatgtcacgtacgcgaatgagctgatgaacagatacgaaattccggaa
acgaaaaaataccgtgagctgtcgacaggcttaaaaaagcagctatcgctcgttctgtcg
tttgcggcgagaccggcgctgatcctccttgatgagccgacggatggtattgatgcggtg
acaaggcatgatgtgctgcagctgatggtcgatgaagtggcagagcgtgatacgagcatc
ctgattacgtcccaccggcttgaagacatagagcggatgtgcaaccgaattggttttctt
gaagataacagcctgaccaacgtcatggatcttgatgagttaaaagaagaatacattaaa
attcaaatggccttcgatacagatgtcaatttggccatcagagagcaaaacattccgatg
ctcgatcaggccggcgtgttttacacagtgctgattccgaaaagcgatgaggagaaaaag
agctttttgagagagctgaagccaaaagtgtggaatgagcttcctgtcaacctggaagaa
gtgttcattgcgaagtttggagggaagcggagatggtag

DBGET integrated database retrieval system