KEGG   Bacillus subtilis subsp. subtilis 168: BSU35160Help
Entry
BSU35160          CDS       T00010                                 

Gene name
uvrA
Definition
(RefSeq) UvrABC system protein A
  KO
K03701  excinuclease ABC subunit A
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    BSU35160 (uvrA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU35160 (uvrA)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     BSU35160 (uvrA)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      BSU35160 (uvrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrA_inter UvrA_DNA-bind ABC_tran SMC_N AAA_16 AAA_29 RsgA_GTPase AAA_22 AAA_23 AAA_25 AAA_21 DnaJ_CXXCXGXG AAA_18 BCA_ABC_TP_C ATPase_2 AAA_14 NACHT ATPase cobW Viral_helicase1 MMR_HSR1 MeaB NB-ARC PRK DUF87 Septin
Motif
Other DBs
NCBI-GeneID: 936646
NCBI-ProteinID: NP_391396
Pasteur: BG12697
BSORF: BG12697
UniProt: O34863
Position
complement(3610064..3612937)
Genome map
AA seq 957 aa AA seqDB search
MAMDRIEVKGARAHNLKNIDVTIPRDQLVVVTGLSGSGKSSLAFDTIYAEGQRRYVESLS
AYARQFLGQMDKPDVDAIEGLSPAISIDQKTTSRNPRSTVGTVTEIYDYLRLLYARVGKP
HCPEHGIEITSQTIEQMVDRILEYPERTKLQVLAPIVSGRKGAHVKVLEQIRKQGYVRVR
IDGEMAELSDDIELEKNKKHSIEVVIDRIVVKEGVAARLSDSLETALRLGEGRVMIDVIG
EEELMFSEHHACPHCGFSIGELEPRLFSFNSPFGACPTCDGLGMKLEVDADLVIPNQDLS
LKENAVAPWTPISSQYYPQLLEAVCTHYGIDMDVPVKDLPKHQLDKVLYGSGDDLIYFRY
ENDFGQIREGEIQFEGVLRNIERRYKETGSDFIREQMEQYMSQKSCPTCKGYRLKKEALA
VLIDGRHIGKITELSVADALAFFKDLTLSEKDMQIANLILREIVERLSFLDKVGLDYLTL
SRAAGTLSGGEAQRIRLATQIGSRLSGVLYILDEPSIGLHQRDNDRLISALKNMRDLGNT
LIVVEHDEDTMMAADYLIDIGPGAGIHGGQVISAGTPEEVMEDPNSLTGSYLSGKKFIPL
PPERRKPDGRYIEIKGASENNLKKVNAKFPLGTFTAVTGVSGSGKSTLVNEILHKALAQK
LHKAKAKPGSHKEIKGLDHLDKVIDIDQAPIGRTPRSNPATYTGVFDDIRDVFAQTNEAK
VRGYKKGRFSFNVKGGRCEACRGDGIIKIEMHFLPDVYVPCEVCHGKRYNRETLEVTYKG
KSISDVLDMTVEDALSFFENIPKIKRKLQTLYDVGLGYITLGQPATTLSGGEAQRVKLAS
ELHKRSTGRTLYILDEPTTGLHVDDIARLLVVLQRLVDNGDTVLVIEHNLDIIKTADYIV
DLGPEGGAGGGTIVASGTPEEITEVEESYTGRYLKPVIERDKTRMKSLLKAKETATS
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atggctatggatcggatagaggtgaagggagccagggcgcataacctgaaaaatatagat
gtaacgattccgagagatcagcttgtcgttgtcacgggtttgtccggatcaggtaaatcc
tcccttgcctttgacacgatatatgctgaaggacagagacggtatgtcgagtcgctgtct
gcctatgcccgccagtttttagggcaaatggataagccggatgtggatgcaattgagggg
ctctctcccgccatcagcattgatcagaaaacaacgagccgcaatccgaggtctactgtc
ggtacggtaactgagatttatgattatctgcgtcttttatatgcgagagtagggaagcct
cattgtccggaacacggaattgagattacatcccagaccatcgagcaaatggtggacaga
attctggaatacccggaacggacgaagcttcaggtgctggcgccgattgtctcgggccga
aaaggcgctcatgtcaaagtgcttgaacagattaggaaacaaggctatgtcagagtcaga
attgacggcgagatggctgagctttccgacgatatcgaattagaaaagaacaagaagcat
tccattgaggtagtcattgaccggattgtcgtgaaagaaggcgtggcagcccggctgtca
gattcattggaaacggcgcttcgtttaggtgaaggacgggttatgatcgatgtcatcggt
gaggaagagctgatgttcagcgagcatcatgcctgtccgcactgcggattttcaattggt
gagcttgagccgcgtctgttttcgtttaacagtccgttcggggcgtgtccgacgtgtgac
ggtctcggaatgaagcttgaagtggatgccgatcttgtcatccccaatcaagatttgtca
ttgaaggagaatgcggtcgccccttggacaccgatcagctcacaatattatcctcagctg
cttgaggcagtctgcacccactacgggattgatatggatgtgccggtcaaagatttgccg
aagcatcaactggataaagtgctgtacggcagcggggatgacctgatttatttccgatat
gaaaatgattttggacaaatccgcgaaggtgaaattcaatttgaaggcgtattgcgcaac
attgaaagacgctataaggagacaggctccgatttcatacgtgagcaaatggagcagtat
atgtctcagaagtcttgtccgacgtgcaaaggctatcggttaaagaaagaggcgcttgcc
gtactgattgacggccgccacattgggaaaattaccgagctgtctgtcgccgacgcactt
gccttctttaaagatcttaccctttctgagaaggatatgcagatcgccaatttgattttg
cgcgaaattgtggagcgcttaagctttctggacaaagtcggcctcgattacctgacattg
agcagggcagcgggtacattgtccggaggagaggcgcagcgcatcaggctggcgactcaa
attggctcgcgtttatccggtgtgctttatattttagatgagccgtctatcggtctgcat
cagcgtgataacgaccgcttgatcagcgctctgaaaaatatgagagacctcgggaacacg
ctgattgttgtcgaacatgatgaggacacgatgatggcagcagattatttaatagatatt
ggaccgggagccggcattcacggcggacaggtgatatctgcgggtacgccggaagaagtg
atggaagatccaaattcattaacgggcagctatttatcagggaaaaagtttatcccattg
cctcctgaaagaagaaagccggacggacgttacattgaaattaaaggtgcatcagaaaac
aacctgaaaaaagtgaatgccaagttcccgcttgggacgtttacagcagttacaggtgtt
tccggttcaggaaagagtacactcgttaatgaaattttgcataaggcgctggcgcaaaag
cttcataaagcgaaagcgaagcccggcagccataaagagattaaaggtttggatcattta
gataaagtcattgacattgaccaggcgccaatcggaagaacgccgagatccaaccctgcg
acatacaccggtgtatttgatgacattcgtgatgtattcgcgcagacaaatgaagcgaag
gtccgcggctataaaaaaggccgtttcagcttcaacgtgaagggcggacgatgtgaagcc
tgccgcggagacgggattattaaaattgaaatgcacttccttcctgacgtatacgttcca
tgcgaggtgtgtcacggcaaacgctataaccgtgaaacgcttgaagtgacgtacaaagga
aaaagcatctctgatgtgcttgatatgacggttgaagatgctctttctttctttgaaaat
atcccgaaaatcaaacgcaagctccaaaccctttatgatgttggtttaggttatattacg
ctcggccagccggcgacgaccttgtcaggcggagaagcgcagcgcgtgaagctcgcgtca
gagctgcacaaacgctcaaccggacgtacgctctacattttagatgagccgacgacaggt
ttgcatgtcgacgatatcgccaggcttcttgtcgtgctgcaacggttggtagacaacgga
gacactgtactggttattgagcacaatcttgatatcattaagacggccgattacattgtg
gatttgggcccggaaggcggagccggaggcggaaccattgtcgcgtctggaacgcctgag
gaaatcactgaagttgaagaatcgtatacaggccgttatttaaagcctgttatcgaacgt
gacaaaacacgcatgaaatcgctcttgaaagcaaaagaaacagctacatcttaa

DBGET integrated database retrieval system