KEGG   Bacillus subtilis subsp. subtilis 168: BSU39110
Entry
BSU39110          CDS       T00010                                 

Symbol
deaD
Name
(RefSeq) ATP-dependent RNA helicase DbpA
  KO
K05592  ATP-dependent RNA helicase DeaD [EC:3.6.4.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BSU39110 (deaD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bsu03019]
    BSU39110 (deaD)
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU39110 (deaD)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     BSU39110 (deaD)
Messenger RNA biogenesis [BR:bsu03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     BSU39110 (deaD)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  rRNA helicases
   BSU39110 (deaD)
SSDB
Motif
Pfam: DEAD Helicase_C DbpA ResIII AAA_19 CMS1 Helicase_RecD SWI2_SNF2
Other DBs
NCBI-GeneID: 937492
NCBI-ProteinID: NP_391790
Pasteur: BG11143
BSORF: BG11143
UniProt: P42305 A0A6M4JQQ3
Structure
PDB: 
2G0C 2HJV 3MOJ

Position
complement(4015987..4017426)
AA seq 479 aa
MSHFKNYQISHDILRALEGLGYTEPTKVQQSVIPAALERKDLVVKSQTGSGKTASFGIPL
CELANWDENKPQALILTPTRELAVQVKEDITNIGRFKRIKATAVFGKSSFDKQKAELKQK
SHIVVGTPGRVLDHIEKGTLPLDRLSYLVIDEADEMLNMGFIEQVEAIIKHLPTERTTML
FSATLPQDIEKLSRQYMQNPEHIEVKAAGLTTRNIEHAVIQVREENKFSLLKDVLMTENP
DSCIIFCRTKEHVNQLTDELDDLGYPCDKIHGGMIQEDRFDVMNEFKRGEYRYLVATDVA
ARGIDIENISLVINYDLPLEKESYVHRTGRTGRAGNKGKAISFVTAFEKRFLADIEEYIG
FEIQKIEAPSQEEVARKKPEFLAKLNDRPESKKDKSEELNKDIMKLYFNGGKKKKIRAVD
FVGTIAKIDGVSADDIGIITIMDNASYVEILNGKGPHVLKVMKNTTVKGKQLKVNKANK
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagtcattttaaaaactatcaaatcagtcatgacattttacgagcattggaaggactg
ggatatacagaaccgaccaaggtgcagcagagtgtgatccccgctgcccttgaacgaaag
gatcttgtcgtcaaatcacagacaggaagcgggaaaacggcttcgttcgggattcctctc
tgtgagctggcgaattgggatgaaaacaagccgcaggcgcttattttaacaccgacccgt
gagcttgcggtgcaagtaaaggaagatatcacgaacatcggacgatttaaacggatcaaa
gcgacagccgtatttggaaaatcctcctttgataaacaaaaagctgagcttaagcaaaaa
agccacattgttgtcggcacgccgggacgtgttctggatcatatcgaaaaaggcacgctg
ccgttggatcgtctctcttatttggtcattgatgaagcggatgagatgctgaatatgggc
ttcattgagcaggtggaggcgattatcaagcatctgccgactgagcgtacgacgatgctg
ttttcagcgacgcttccgcaggatatcgagaagctgagccgtcaatatatgcaaaacccc
gagcatatcgaggtcaaagcggccggcctaaccacaagaaatattgaacatgcggtgatt
caagtaagagaagagaataagttttcattgctgaaagatgtgctgatgacggagaatccc
gacagctgcatcattttctgccgaacgaaggagcacgtcaatcagctgaccgatgaattg
gatgacttgggatatccatgcgataaaattcacggcggaatgattcaggaagaccgattc
gacgtcatgaatgaatttaaacgtggcgagtaccgttacttagtggcgacggatgtcgcc
gcgcgcgggattgatattgaaaatatctcccttgtcatcaactatgatctgccgcttgaa
aaagaaagctatgtccaccgcacgggccgaacgggacgcgcagggaacaaaggaaaggcc
atttcgtttgtcacggccttcgaaaaacggtttttagccgacattgaagaatatatcgga
tttgaaatccaaaaaatagaagcaccttctcaagaggaagtggcaaggaagaaaccagaa
tttctagctaaactgaatgaccgtccggaaagcaaaaaggacaaaagcgaagagctgaat
aaagacattatgaagctgtattttaacggcggaaagaaaaagaaaatcagagccgttgat
tttgtaggaacgattgccaaaattgacggtgtgtcagctgacgacatcggcatcatcacg
atcatggataacgcctcatacgttgagattttaaatggtaaaggccctcatgttctcaaa
gtgatgaagaacacaaccgtcaaagggaaacagctgaaggtgaataaagcgaataaatga

DBGET integrated database retrieval system