KEGG   Camelus dromedarius (Arabian camel): 105085966
Entry
105085966         CDS       T04642                                 

Gene name
MECOM
Definition
(RefSeq) histone-lysine N-methyltransferase MECOM isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04010  MAPK signaling pathway
cdk05200  Pathways in cancer
cdk05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105085966 (MECOM)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105085966 (MECOM)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    105085966 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105085966 (MECOM)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    105085966 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_8 zf-C2H2_11 SET PyrI_C
Other DBs
NCBI-GeneID: 105085966
NCBI-ProteinID: XP_010974622
Position
1
AA seq 1212 aa
MPDADGVASTLSLSIQEPCSPATSSEAFTPKEGSPYKAPIYIPDDIPIPAEFELRESNMP
GAGLGIWTKRKIEAGEKFGPYVGEQRSNLKDPSYGWEILDEFCNVKFCIDASQPDVGSWL
KYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLFMKSEDYPHETMAPDIHEERQ
YRCEDCDQLFESKAELADHQKFPCSTPHSAFSMVEEDFQQKLESENDLREIHSIQECKEC
DQVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKQV
FTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQ
FSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFAAGGFFGQGISLPG
TPAMDKTSMVNMSHANPGLADYFGANRHPAGLTFPTAPGFSFSFPGLFPSGLYHRPPLIP
ASSPGKGLSSTEQTNKSQSPLMTHPQILPATQDILKALSKHPPVGDNKPVELQPERSSEE
RPLEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDIESDKEKFKENGKMFKDKVSPLQ
NLASIHNKKEYSNHSIFSPSLEEQTAVSGAVNDSIKAIASIAEKYFGSAGLVGLQDKKVG
ALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPLKMEPQSPSEVKKLQKGSSESPFDLTTK
RKDDKPLTPVPAKPPATPATSQDQPLDLSMGSRSRASGTKLTEPRKNHVFGEKKGANAEP
RPASDGSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKYLRPSPGFLFHPQFQLPDQRT
WMSAIENMAEKLESFSALKPEASELLQSVPSMFNFRAPPNALPENLLRKGKERYTCRYCG
KIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCF
GQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKEDAYFTEIRNFIGDSNHSGQ
SPRNTEERMNGSHFKDEKALVTSQNSDLLDDEEVEDEVLLDEEDEDNDIPGKTGKEPVTS
NLHEGNPEDDYEETSALEMSCKTSPVRYKEEEYKTGLSALDHIRHFTDSLKMRKMEDNQY
TEAEVSSFSASHVPEELKQPLHRKSKSQAYAMMLSLSDKESLHSSSHSSSNVWHSMARAA
AESSAIQSLSHV
NT seq 3639 nt   +upstreamnt  +downstreamnt
atgccagatgcagatggagtagccagcactctttccctcagtattcaagagccatgctct
ccagccacgtccagcgaagcattcactccaaaggagggctctccttacaaagcccccatc
tacatccctgatgatatccccattcccgcggagtttgagcttcgagagtcaaatatgcct
ggagcaggactaggaatatggaccaaaaggaaaattgaagcaggtgaaaagtttgggcct
tatgtgggagagcagaggtcaaacctgaaagaccccagttatggatgggagatcttagat
gagttttgcaatgtgaagttctgcatagatgctagtcaaccagatgtaggaagctggctc
aagtacatcaggttcgctggctgttatgatcagcacaacctcgttgcatgccagataaat
gatcagatattttatagagtagtggcagacatcgccccgggagaggagctcctgctgttc
atgaagagtgaagactatccccatgaaactatggcgccagatatccacgaagaacggcag
taccgctgtgaggactgtgaccagctctttgagtccaaggctgagctagcggaccaccag
aagttcccgtgcagcacccctcactcagcattctccatggtggaagaggacttccaacaa
aaactcgaaagtgaaaatgatctccgagagatacactcaatccaggagtgtaaggaatgt
gaccaagtctttcctgatttgcaaagcctggagaaacacatgttgtcacatacggaagag
agggagtacaagtgcgatcagtgtcccaaggcatttaactggaagtccaatttaattcgc
caccagatgtcacatgacagtggaaagcactatgaatgtgaaaactgtgccaagcaggtt
ttcacggaccctagcaacctgcagcggcacatccgctctcagcacgttggtgcccgggcc
cacgcgtgcccggagtgtggcaaaacgtttgccacttcgtcgggcctcaaacaacacaag
cacatccacagcagtgtgaagccctttatctgtgaggtctgccataaatcctatactcag
ttttcaaacctttgtcgtcataagcgcatgcatgctgattgcagaacccaaatcaagtgc
aaagactgtggacaaatgttcagcactacgtcttccttaaataaacacaggaggttttgt
gagggcaagaaccattttgcggcaggtggattttttggccaaggcatttcacttcctgga
accccagctatggataaaacgtccatggttaatatgagtcatgccaacccgggccttgct
gactattttggcgccaatagacatcctgctggtcttacctttccaacagctcctggattt
tcttttagcttccctggtctgtttccttccggcttgtaccacaggcctcctttgatacct
gctagttctcctggtaaaggactatcaagtactgaacagacaaacaaaagtcaaagtccc
ctcatgacacatcctcagatactgccagctacacaggatattttgaaggcactatctaaa
cacccacctgtaggggacaataagccagtggagctccagcccgagaggtcctctgaagag
aggccccttgaaaaaatcagtgaccagtcagagagtagtgaccttgatgatgtcagtaca
ccaagtggcagtgacctggagacaacctcgggctctgatctggaaagtgacattgaaagt
gataaagagaaatttaaagaaaatggtaaaatgttcaaagacaaagtaagccctcttcag
aatctggcttcaatacataataagaaagaatacagcaatcattccattttctcaccatct
ttagaggagcagactgcggtgtcaggagctgtgaatgattctataaaggctattgcttct
attgctgaaaaatactttggttcagcaggactggtggggctgcaagacaaaaaagttgga
gctttaccttacccttccatgtttcccctcccgttttttccagcattctcccaatcaatg
tacccatttcctgatagagacttgagatcgttacccttgaaaatggaaccccaatcacca
agtgaagtaaagaaactgcagaagggaagctctgagtctccctttgatctcaccactaag
cgcaaggacgacaagcccttgaccccagtacccgccaagcctcctgcaacacccgccaca
agccaagaccagcccctggatctaagcatgggcagtaggagtagagccagtgggaccaag
ctcaccgagccccgtaaaaaccacgtgtttggggaaaagaaaggagccaacgctgagcca
agaccagcatctgatggttccttacagcatgctagacccactcccttctttatggaccct
atttacagagtagagaaaagaaaactaactgacccacttgaagctttaaaagagaaatac
ttgagaccgtctccaggattcctatttcacccacaattccaactgcctgatcagagaact
tggatgtcagccattgaaaacatggcagagaagctggagagcttcagcgccctgaaacct
gaggccagtgaacttctacagtcggttccctccatgttcaacttcagagctcctcccaac
gccctgccagagaacctcctgcggaaaggaaaggaacgctatacttgcagatactgtggc
aagatttttccaagatctgcgaatctaacacggcacttgagaacccacacaggagagcag
ccttacagatgcaaatactgtgacagatcattcagcatatcttctaacctgcagcggcac
gttcgcaacatccacaataaggagaagccctttaagtgtcacttatgtgataggtgtttt
ggtcaacaaaccaacttagacagacacctaaagaaacacgagaatgggaacatgtctggt
acagcaacatcgtcgcctcattctgagctggaaagcacgggtgcgattctcgatgacaag
gaagatgcttacttcacagaaatccgaaatttcattggggacagcaaccacagcggccag
tctccccggaacacagaggagagaatgaatggcagtcactttaaagatgaaaaggctttg
gtgaccagtcaaaattcggatttactggatgatgaagaagtagaagatgaggtgttatta
gatgaggaggatgaagacaatgatattcctgggaagacaggaaaggaaccagtgacaagt
aacttacacgaaggaaaccctgaggatgactatgaagaaaccagcgccctggagatgagt
tgcaagacatccccagtgaggtataaagaggaagaatataaaactggactttctgctcta
gatcatatcaggcacttcacagatagcctcaaaatgaggaaaatggaagataatcaatac
actgaagctgaggtgtcttctttcagtgcttcccatgtgccagaggaacttaaacagccg
ttacacagaaagtccaaatcacaggcatatgctatgatgctatcattgtccgacaaggag
tccctccactcttcatcccacagttcctccaacgtgtggcacagcatggccagggctgca
gcggaatccagcgccatccagtccctgagccacgtatga

DBGET integrated database retrieval system