KEGG   Caenorhabditis elegans (nematode): CELE_Y37A1B.2
Entry
CELE_Y37A1B.2     CDS       T00019                                 

Gene name
lst-4
Definition
(RefSeq) Sorting nexin lst-4
  KO
K17923  sorting nexin-9/18/33
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_Y37A1B.2 (lst-4)
Membrane trafficking [BR:cel04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    CELE_Y37A1B.2 (lst-4)
  Macropinocytosis
   Sorting nexins
    CELE_Y37A1B.2 (lst-4)
SSDB
Motif
Pfam: BAR_3_WASP_bdg PX SH3_9 SH3_1 SH3_2 DUF2680 Vps5
Other DBs
NCBI-GeneID: 178361
NCBI-ProteinID: NP_872090
WormBase: WBGene00003086
UniProt: Q8I4E2
Position
IV:complement(join(14061369..14061602,14062162..14062328,14062388..14062465,14062521..14062624,14062690..14063024,14063071..14063427,14066808..14067029,14069047..14069148,14069755..14069850))
AA seq 564 aa
MAQVKAEYDFQSQPNTGELSISAGEVLTVIRENIDGGWIEGRNVRGSVGLFPESYVTPYQ
ASRPPPVLPPPLPPTSSGPPAASSRPFDDWGGASEVAAPPSYGAQHHHQPTPSVPEVTRS
SYPSQNDDFDDEWTDEDDEQEPTRPNVQSSIGSNSRRDLSRSHSEHGGPDRGSNKVNKNI
NRFSNFVKSGVEAYVIGESKTTSQISERHEVVMNNGIIQWKPIQQYYTCIVDKPKKESKL
KGLKSFIAYSITSSLTNIQVSRRYKHFDWLHEQLSAKYVLIPIPPLPEKQVAGRYEEDLI
DHRKHILQLWVNKICRHPVLSQSEVWLHFISCTDEKDWKNGKRRAEKDEYIGGAFLNCIT
VPHQPLDPNNVDMQVERFQRSVKTSEEAMRVMQERMNMFQKVFAGPVKQNWQKMGSAFKT
LQQSFEIDETVASRRLTEALAYTASEYHEIGQVFDAHTKNDMEPVLENLYSYKGTVQNVP
DIIQVHKQAVQKFRDSEGRLSSAEAEKMKQRIDAMSYTVIAEVQHQTAEKVEDMKSTMGT
YLKKQAMFYQEVATKLTSLAARYD
NT seq 1695 nt   +upstreamnt  +downstreamnt
atggctcaggtgaaagccgagtatgattttcaaagtcaaccaaacacaggcgaactgtca
atctcggctggcgaagttttgacggttattcgagagaacatcgacggaggatggatagaa
ggtcgaaacgtgcgtggatccgtcggactctttcccgaatcctacgtaactccctatcaa
gcttctcgtccgccaccggtcctaccaccaccactcccaccaacttcaagcggtccacca
gctgcctcatcgcgtccttttgatgattggggaggcgcttcagaagttgctgctccacca
tcctacggagcccaacatcatcatcagccaacgccatctgtaccggaagtcactagatct
tcatatccatcacagaatgatgattttgacgatgaatggacggatgaggatgatgagcag
gaaccaactcggcccaacgttcaatcctcgatcggctcgaactcccgtcgtgacctcagc
cgtagccactcggaacacggtggacctgatcgaggatccaataaggtcaacaagaacatc
aatcgattctcgaattttgtaaagtccggagtcgaagcgtacgtgattggtgaatcaaag
accacctcacagattagtgaacgacatgaagttgtgatgaacaatggaattattcaatgg
aaaccgattcaacagtactacacgtgtatagtggataaaccgaagaaagagtcaaagctg
aaagggctgaagagcttcatcgcatattcgattacgtcgagtttgactaatattcaggta
tcccgtcgctacaagcatttcgattggctccacgagcagctatcggctaaatatgtgctc
attccgattccaccgttgccagagaaacaggtcgccggaagatacgaggaggatcttatt
gatcatcggaagcacattcttcagttatgggtcaacaagatttgtaggcatccagtgttg
agtcagtcggaagtttggctccactttatcagttgcaccgacgaaaaagattggaagaat
gggaagcggcgagctgaaaaggatgaatacattggtggagctttcctgaactgtatcact
gttccacatcaaccattggatccgaataatgtcgatatgcaagttgaacgattccaacgg
agcgtcaaaacatcggaagaagcgatgcgtgtgatgcaggagagaatgaacatgttccag
aaggtcttcgctggaccggtaaaacaaaattggcaaaagatgggaagcgcgttcaagaca
cttcagcaatcttttgagattgatgagaccgttgccagtcgccgcctgacagaagctctc
gcctacactgcatcagaatatcatgaaattgggcaagtattcgatgcgcacacgaagaat
gacatggaaccagtgcttgagaacctttattcgtataagggaacagtgcaaaatgtgccg
gatattattcaagtgcacaagcaagctgttcaaaagttccgtgacagcgaaggacgtctc
tcgtcggccgaggctgaaaagatgaagcaaagaatcgatgcgatgagctacactgtaatt
gctgaagttcaacatcaaacagcagagaaagtggaggatatgaaatcgacaatgggcaca
tatttgaagaaacaagcaatgttttatcaggaagtggcgaccaagctgacttcattagcc
gctagatatgattga

DBGET integrated database retrieval system