KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100405015
Entry
100405015         CDS       T03264                                 
Symbol
FNBP1L
Name
(RefSeq) formin binding protein 1 like
  KO
K20121  formin-binding protein 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100405015 (FNBP1L)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    100405015 (FNBP1L)
SSDB
Motif
Pfam: FCH SH3_1 SH3_9 SH3_2 SH3_3 Lzipper-MIP1 DUF5660 HR1 DEDD_Tnp_IS110 EcsC DUF4140 COG5 Exonuc_VII_L FapA
Other DBs
NCBI-GeneID: 100405015
NCBI-ProteinID: XP_008999978
Ensembl: ENSCJAG00000017821
UniProt: F7G804
Position
7:129920024..130038590
AA seq 605 aa
MSWGTELWDQFDSLDKHTQWGIDFLERYAKFVKERIEIEQNYAKQLRNLVKKYCPKRSSK
DEEPRFTSCIAFFNILNELNDYAGQREVVAEEMAHRVYGELMRYAHDLKTERKMHLQEGR
KAQQYLDMCWKQMDNSKKKFERECREAEKAQQSYERLDNDTNATKADVEKAKQQLNLRTH
MADENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTVKLSECYRGFADSERKV
IPIISKCLEGMILAAKSVDERRDSQMVVDSFKSGFEPPGDFPFEDYSQHIYRTISDGTIS
ASKQESGKMDAKTTVGKAKGKLWLFGKKPKPQSPPLTPTSLFTSSTPNGSQFLTFSIEPV
HYCMNEIKTGKPRIPSFRSLKRGWSVKMGPALEDFSHLPPEQRRKKLQQRIDELNRELQK
ESDQKDALNKMKDVYEKNPQMGDPGSLQPKLAETMNNIDRLRMEIHKNEAWLSEVEGKTG
GRGDRRHSSDINHLVTQGRESPEGSYTDDANQEVRGPPQQHGHHSEFDDEFEDDDPLPAI
GHCKAIYPFDGHNEGTLAMKEGEVLYIIEEDKGDGWTRARRQNGEEGYVPTSYIDVTLEK
NSKGS
NT seq 1818 nt   +upstreamnt  +downstreamnt
atgagctggggaacggagctgtgggatcagttcgacagcttagacaagcatacacaatgg
ggaattgacttcttagaaagatatgccaaatttgtcaaagagaggatagaaattgaacag
aactatgcgaaacaactgagaaatctggttaagaagtactgccccaaacgttcatccaaa
gatgaagagccacggtttacctcgtgtatagccttttttaatatccttaatgagttaaat
gactatgcaggacagcgagaagttgtagcagaagaaatggcgcacagagtgtatggtgaa
ttaatgagatatgctcatgatctgaaaactgaaagaaaaatgcatctccaagaaggacga
aaagctcaacaatatcttgacatgtgctggaaacagatggataatagtaaaaagaagttt
gaaagagaatgtagagaggcagaaaaggcacaacagagttatgaaagattggataatgat
actaacgcaaccaaggcagatgttgaaaaggccaaacagcagttgaatctacgtacgcat
atggctgatgaaaataaaaatgaatatgcagcacaattacaaaactttaatggagaacaa
cacaaacatttttatgtagtgattcctcagatttacaagcaactacaagaaatggacgaa
cgaaggactgttaaactcagtgagtgttacagaggatttgccgattcagaacgcaaagtt
attcctatcatttcaaaatgtttggaaggaatgattcttgcagcaaaatcagttgatgaa
agaagagactctcaaatggtggtagactccttcaaatctggttttgaacctccaggagac
tttccgtttgaagattacagtcaacatatatatagaaccatttctgatgggactatcagt
gcatccaaacaggagagtgggaagatggatgccaaaaccacagtaggaaaggccaagggc
aaattgtggctctttggaaagaagccaaagccacagtccccacccttaacccctactagt
ttattcacatccagtactcctaatgggtcccagtttctcacattctccattgagcccgtg
cattattgtatgaatgaaataaaaacagggaagcccagaattccttctttcagaagcctc
aaaagagggtggtcggtgaagatgggcccagcattggaagatttcagtcatctgccacca
gaacagagacgtaaaaaactacagcagcgcattgatgaacttaatagagagctacagaaa
gaatcagaccaaaaagatgccctcaacaaaatgaaagatgtatatgagaagaatccacaa
atgggggatccagggagtttgcagcctaaattggcagagaccatgaataacattgaccgc
ctacgaatggaaatccacaagaatgaggcttggctttctgaagttgaaggcaaaacaggt
gggagaggagacagaagacatagcagtgacataaatcatcttgtaacacagggacgagaa
agtcctgagggaagttacactgatgatgcaaaccaggaagtccgtgggccaccccagcag
catggccatcacagtgagtttgatgatgaatttgaggatgatgatcccttgcctgctatt
ggacactgcaaagctatctacccttttgatggacataatgaaggtactctggcaatgaaa
gaaggtgaagttctctacattatagaggaggacaaaggtgatggatggacaagagctcgg
agacagaacggtgaagaaggctacgttcccacgtcatacatagatgtaaccctagagaaa
aacagtaaaggttcctga

DBGET integrated database retrieval system