KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100415304
Entry
100415304         CDS       T03264                                 

Gene name
CYP11B2
Definition
(RefSeq) cytochrome P450, family 11, subfamily B, polypeptide 2
  KO
K07433  steroid 11beta-monooxygenase / corticosterone 18-monooxygenase [EC:1.14.15.4 1.14.15.5]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00140  Steroid hormone biosynthesis
cjc01100  Metabolic pathways
cjc04925  Aldosterone synthesis and secretion
Module
cjc_M00108  C21-Steroid hormone biosynthesis, progesterone => corticosterone/aldosterone
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100415304 (CYP11B2)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    100415304 (CYP11B2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cjc00199]
    100415304 (CYP11B2)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.4  steroid 11beta-monooxygenase
     100415304 (CYP11B2)
    1.14.15.5  corticosterone 18-monooxygenase
     100415304 (CYP11B2)
Cytochrome P450 [BR:cjc00199]
 Cytochrome P450, animal type
  CYP11 family
   100415304 (CYP11B2)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 100415304
NCBI-ProteinID: XP_008981388
Ensembl: ENSCJAG00000021462
UniProt: F7HJJ9
Position
16
AA seq 515 aa
MALWAKAEVCMAVPWLSLQGARALGTRAAQAPRTVLPFEAMPQRPGNRWLRLLQIWREQG
YEHLHLELHQTFQELGPIFRSELGGPRTVWVMLPEDVERLQQVDSLHPRRMSLEPWVAYR
QHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKALQRFLPMVDSVARDFSQALRNKVLQNT
RGSLTLDIQSSIFHYTIEASNLALFGERLGLVGHSPSSASLSFLHALEVMLKSTVQLMFM
PRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQHYTGIVAELLLNAELS
LDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKAIT
ELPLLRAAIKESLRLYPVGPFVERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPSP
ERYNPQRWLDMKGSGRNFHHVPFGFGMRQCLGRRLAETEMLLLLHHVLKHFQVETLTQED
ITMAYSFILRPSTYPLLTFRALHPGSQPGHQPPSP
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggcactctgggcaaaggcagaggtgtgcatggcagtgccttggctgtccctgcaaggg
gcacgggcactgggcaccagagccgctcaggcccccaggacggtgctgccctttgaagcc
atgccccagcgtccaggcaacaggtggctaaggctgctgcagatctggagggagcagggt
tatgagcatctgcacctggagctgcaccagaccttccaggagctagggcccattttcagg
tccgagttgggaggaccacgcacggtgtgggtgatgctgccggaagatgtggagaggctg
cagcaggtggacagcctgcacccccgccggatgagcctggagccctgggtggcctacaga
caacatcgtgggcacaaatgtggcgtgttcttgctgaacgggcctgaatggcgcttcaac
cgattgcggctgaaccccgatgtgctgtcacccaaggctctgcagaggttcctcccgatg
gtggattcggtggccagggacttctcccaggccctcaggaacaaggtgctgcagaacacc
cggggcagcctgaccctggacatccaatccagcatcttccactacaccatagaagccagc
aatttagccctttttggagagcggctgggcctggttggccacagccccagctctgccagc
ctgagcttcctccatgccctggaggtcatgctcaaatccaccgtccagctcatgttcatg
cccaggagcctgtctcgctggaccagccccaaggtgtggaaggagcactttgaagcctgg
gactgcatcttccagtatggagacaactgtatccagaaaatctatcaggaactggccttc
agccgccctcaacactacacgggcatcgtggcagagctcctgttgaatgcggaactgtca
ctagatgccatcaaggccaactcgatggaactcactgcagggagcgtggacacgacggtg
tttcccttgctgatgacgctctttgagctggctcggaaccccaacgtgcaacaggctctg
cgccaggagagcctggccgccgcagccagcatcagtgaacatccccagaaggcaatcacc
gagctgcccctgctgcgggcggctatcaaggagagcttgaggctctaccctgtgggcccc
tttgtggagcgagtggtgagctcagacttggtgctgcagaactaccacatccccgctggg
acactggtgcaggttttcctctactcgctgggtcgcaatgccgccttgttcccaagccct
gagcgctacaacccccagcgctggctagacatgaagggctctggcaggaacttccaccac
gtgccctttggctttggtatgcgccagtgcctgggaaggcgcctggcagagacagagatg
ctgctgctgctgcaccacgtgctgaaacacttccaggtggagacgctaacccaagaggac
ataacgatggcctacagcttcatactgaggcccagcacgtatcccctcctcaccttcagg
gctctgcacccagggtcccagcctggccaccagcctccctctccctga

DBGET integrated database retrieval system