KEGG   Cupriavidus necator N-1: CNE_1c27860
Entry
CNE_1c27860       CDS       T01564                                 
Name
(GenBank) hypothetical protein
Organism
cnc  Cupriavidus necator N-1
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 Cpta_toxin TniB
Other DBs
NCBI-ProteinID: AEI78100
UniProt: G0ETQ1
Position
1:complement(2887341..2889512)
AA seq 723 aa
MAKSRNIEVLLRPAVELYTVAACAGAALLCLTAPWSLALSPLLGLGSALAFLIFGAIRLR
DVWAILRYRRNIRRLPRYVMTSRDVPVSQQRLFVGRGFRWDQRHTQRLMQTYRPEFRHYV
EPTTLYRAARRIEARLEFAPFPVSRLAKALAWDSRLNPARPLPPVGGLPRLHGIEPHEVD
VTLPLGERVGHTLVLGTTRVGKTRLAELFITQDIRRKVGDQHEVVIVFDPKGDADLLKRM
YVEARRAGREGEFYTFHLGWPDISARYNAVGRFDRISEVATRIAGQLSAEGNSAAFREFA
WRFVNIIARALVELGQRPDYLLIQRHVINIDTLFIEYAQHFFAKSEPKAWEVIVQLEARL
NDRNTPRNMIGREKRVVALEQYLSQVHIYDPVLDGLRSAVRYDRTYFDKIVASLLPLLEK
LTTGKIAPLLAPNYSDLNDLRPIFDWMQIIRKRAVVYVGLDALSDAEVAAAVGNSMFSDL
VSVAGHIYKFGIEEGLPGPSTGVKVPINVHADEFNELMGDEFIPMVNKGGGAGIQVTAYT
QTLSDIEARMGSRAKAGQLIGNFNNLFMLRVRETATAELLTRQLPKVEVYAATVTSGAID
SSDPSGNTAFTSNTQDRISSTSVPLIEPAHVVALPKGQCFALIEGGNLWKIRMPLPAADP
DEVMPKDLQELAAYMRQHYGEAGDWWASQGVPVSQKQAFPDDLQANSQQTTAANEAGGED
VET
NT seq 2172 nt   +upstreamnt  +downstreamnt
atggccaagtcccggaacatcgaggttctgctgcgccccgcggtggagctgtacaccgtc
gcggcctgtgcgggcgccgcgctgctgtgcctgacggcaccgtggtcgctcgcgctgagc
cctctgttgggcctgggtagcgcgcttgcgttcctcatcttcggcgccatccggctgcgg
gacgtctgggccatcctccgctaccgacgcaacatccgcaggctaccgcgctacgtgatg
accagccgggacgtgcccgtcagccaacagcggctattcgttggccgtggctttcgatgg
gaccagcgccatacgcagcggcttatgcagacctaccggccggagttccgccactacgtg
gaaccgacaacgctctaccgagcggcgcggaggattgaggcgcggctggagttcgcgcca
ttccctgtgtccaggttggcgaaggctctggcctgggacagtcggctcaatccagcgcgc
ccgctgccgccagtcggcggcctgccacgtctgcacggcatcgagccgcacgaggtcgac
gtcacgctgccgttgggcgagcgggtcggccacacgctggtgctgggcaccacgcgcgtg
ggcaagacccgcctggccgagctgttcatcacccaggacatccgccgcaaggtgggcgac
cagcacgaggtggtgatcgtcttcgacccgaagggggacgccgacctgctcaagcgcatg
tacgtggaggccaggcgcgccggcagggaaggggagttctacaccttccacctgggctgg
ccggacatctcggcacgatacaacgccgtgggccgtttcgaccggatatcggaggttgcc
acgcgcattgcgggccagctttcggccgagggcaacagcgcagcgttccgcgagttcgcc
tggcgctttgtcaacatcatcgcgcgcgcgctggtcgagctggggcagcgtcccgactac
ctgctgatccagcgccacgtcatcaatatcgacacgttattcatcgagtacgcccagcac
ttcttcgccaagagcgagccgaaagcctgggaggtcatcgtccagctcgaggcgcggcta
aacgacaggaacacgccgcgcaacatgatcggccgcgagaagcgggtcgtggcgctggag
caatacctttcgcaagtgcacatctatgaccccgtgctcgatggcctgcgtagtgccgtg
cgctacgaccgcacctatttcgacaagatcgttgctagcctgctgccgctcttggagaag
ctgaccaccggaaagattgcgccactgctcgctccgaactactcggacttgaacgacctg
cggcccatctttgattggatgcagatcatccgcaaacgcgccgtggtctacgtcgggctg
gacgcgctatcggacgccgaagtcgcggccgccgtgggcaactcaatgtttagcgacctg
gtatcagtcgccggccacatctacaaatttggcatcgaggaaggtctgccgggcccatcg
accggcgtgaaggtgcccatcaacgtccacgccgacgagttcaacgaactgatgggggac
gaattcataccgatggtcaacaagggcggcggcgccgggatccaagtgacagcctacacg
cagaccctttctgacatcgaggcgcgcatgggtagccgcgccaaggccgggcagctgatc
ggcaacttcaataacctgtttatgctgcgcgtgcgcgagaccgccacggccgaactgctg
acgcggcaactgccgaaggtcgaggtgtatgccgccacggtgacgagcggcgcgatcgac
agctcggacccgagcggcaacaccgcctttacctccaacacccaggatcgcatcagcagc
accagcgtgccgttgatcgagcccgcgcacgtggtcgcgttgcccaaggggcaatgcttc
gcgctgatcgaaggcggaaatctatggaagatccgcatgccgctccccgccgccgacccc
gatgaggtcatgccaaaggatctccaggaactcgccgcctacatgcggcagcactatggc
gaggcgggtgactggtgggcgagtcaaggcgttcctgtctcgcagaaacaagcgtttcca
gacgatctgcaagcgaactctcagcagactaccgcggccaatgaggctggtggcgaagac
gtcgaaacatga

DBGET integrated database retrieval system