KEGG   Cryptococcus neoformans var. neoformans JEC21: CNA04190
Entry
CNA04190          CDS       T00243                                 

Definition
(RefSeq) palmitoyltransferase, putative
  KO
K20032  palmitoyltransferase ZDHHC13/17 [EC:2.3.1.225]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Brite
KEGG Orthology (KO) [BR:cne00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cne04131]
    CNA04190
Enzymes [BR:cne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     CNA04190
Membrane trafficking [BR:cne04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    CNA04190
SSDB
Motif
Pfam: DHHC Ank Ank_2 Ank_4 Ank_5 Ank_3
Other DBs
NCBI-GeneID: 3253361
NCBI-ProteinID: XP_566783
UniProt: P0CS66
Position
1:complement(join(1125651..1125812,1125867..1126477,1126531..1126617,1126669..1126694,1126742..1126806,1126859..1126921,1126973..1127236,1127287..1127415,1127463..1127816,1127872..1128001,1128054..1128283,1128363..1128572))
AA seq 776 aa
MDQEMTTVASPDIRVKATSPDSNRAVLEQSIVLSDSGRLDEGSSIRGGELERDSQEVGRE
TVREPLMCHDLDIHALAQRGDTAAIAAMLQENPSLNLSARDAQDVTPLHWAAINAHMGTC
RLLIDSGADIDAIGGELKATPLQWAARNGHLYVVHLLISRGADPNIHDSQGFNTLHLITH
SSAVMPLLYMLHQPVAIDEKDTDGHTALMWAAYQGDALSVDLLIRHGASVNSTDNAGMTP
LHWAAVKGNKVSIMHLVEAGASLDAKEEAGKTPRDMAEELRGLVPFQKGLEEAGWSIDGV
KMEGKLGPRNTILAIFLLPIAVLWLIFSTFKWLPVYVGVPFAIAEFMGMQYTVVLVLLGH
IKAQDKVSTSNYFASIITASLIWVGYCWISRFAVNTPGYAFSNLGFIIMFVGCCWTFWTA
IVTDPGFVPKGQQDAEIKEVLEDLVDAGRLNGTNFCIVCMARKPLRSKHCRTCNRCVARF
DHHCPWIWNCVGAKNHRSFLLFVLFLIGGIILFIRLTIAYIQQNAPEYIPTPNPGLTTCD
ISTTLCQAGDFDPFLLCMALWSTLQLTWTSVLAISHLWQVSRQMTTFEVSNLGRYGFMGG
RGGQSLRDQSGAMLKQAAAVGAGIGMSGAGEEAAGPPGAEAGPEGNALLPPPGGHVHGPQ
CRHGDHARGHSHGVLHICGALWKTLTGPLMTILGLDRFTKGKALGGMKRAGRDQNPFDMG
MVKNCIDFWLPDNDVDYMTVYEIPPGGWRAYRRKLAMDKRVPGGKGRYEVVSEQEV
NT seq 2331 nt   +upstreamnt  +downstreamnt
atggaccaagagatgactacagtggcatctccagacattagggtgaaagcgacaagccca
gactcaaatcgagctgtacttgaacaatcaatagtcctgtcagattcaggcaggttagat
gaaggaagctcaattcgaggcggagagcttgaaagggacagtcaggaggtcggccgggaa
actgtacgagagcctttgatgtgtcacgacctcgacatccatgcactggctcagaggggc
gatacggcagccatcgctgctatgctacaagagaacccttcactaaacctctctgccaga
gacgctcaagatgtgacacctttacactgggccgctattaacgcgcacatgggaacatgt
agactcctaatagacagtggcgctgatatcgacgcgattggtggtgagctgaaagctact
cctttgcaatgggctgcaagaaatggacatttatatgttgtacatctcttaatatcaagg
ggtgctgacccaaatatacatgactctcaaggctttaatacgttgcacctcatcactcat
tccagtgccgtcatgccgctgctatacatgcttcatcaaccggtagctatcgatgaaaag
gatacagatggtcatactgctctcatgtgggcagcttatcaaggcgacgctctttcagtc
gatctcctcattagacacggtgcttcagtgaactcgaccgacaatgcgggtatgactcct
cttcactgggcagcggtgaaaggcaacaaggtctccatcatgcaccttgtagaagccggt
gctagtctcgatgcgaaagaagaagcagggaagactcccagagatatggcagaggagttg
aggggtctagtgccgttccaaaagggtctcgaggaggcagggtggagcattgatggtgtg
aagatggaaggcaaattgggccctagaaataccatcctggctatcttcttgttgcccata
gcagtgctatggctcatcttcagtactttcaagtggttaccggtatacgtgggcgtcccg
tttgccattgctgaattcatgggcatgcaatacaccgtcgtccttgttttattgggccat
atcaaggcccaagacaaagtttccacatccaactactttgcatctatcatcaccgccagt
ctcatctgggtaggctactgttggatttctaggttcgccgtcaacaccccgggatacgca
tttagcaacctcggctttataatcatgtttgttggctgctgttggactttctggacagcc
atcgtgacagatcctggatttgtgccgaagggacagcaggatgcggaaattaaggaagta
ttagaagaccttgtggacgcaggaagactgaatgggaccaacttttgtatcgtctgcatg
gctcggaaacccttacgctccaaacattgccggacctgtaatcgatgtgtggccaggttt
gatcaccactgcccttggatttggaattgcgtgggagcgaaaaaccatcgatcctttttg
ctatttgtgttatttttgattgggggaatcattctctttatcagacttactattgcctac
atccagcaaaatgccccagaatacattcccactcctaatccaggattaacaacatgtgat
atctctacaactctctgccaagcaggcgatttcgatccttttcttctctgtatggcgctt
tggagtacccttcaactcacgtggacttctgttctggccatttctcacctatggcaagtc
tctcggcaaatgacaacatttgaagtgtccaatcttggccgatatggcttcatgggtggg
cgagggggacaaagcttgagagaccaaagcggggcgatgttaaagcaggctgcagctgtc
ggggcgggcatcgggatgagtggagctggagaggaagcggctggtcccccgggtgccgag
gctgggccagaggggaacgcgttacttcctccgcctggcggacatgttcatggacctcaa
tgtcgacatggtgatcatgctcgtggccacagccatggcgtgctgcatatatgcggagct
ctttggaagacattgacaggtccgctgatgactatcttgggactagataggtttacgaag
ggaaaggcattggggggaatgaaaagagctgggagagaccagaatccgtttgatatgggc
atggtcaaaaattgcatagatttctggttaccagataacgatgtcgattatatgacggtt
tacgaaatacctccaggaggttggagggcttataggcgaaagcttgcgatggataagaga
gtaccgggtgggaaaggacgttatgaggtcgttagcgagcaagaggtatag

DBGET integrated database retrieval system