KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ005741
Entry
CpipJ_CPIJ005741  CDS       T01079                                 
Name
(GenBank) calmodulin-binding protein trpl
  KO
K13803  transient-receptor-potential-like protein
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04745  Phototransduction - fly
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09150 Organismal Systems
  09157 Sensory system
   04745 Phototransduction - fly
    CpipJ_CPIJ005741
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cqu04040]
    CpipJ_CPIJ005741
Ion channels [BR:cqu04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   CpipJ_CPIJ005741
SSDB
Motif
Pfam: Ion_trans TRP_2 PKD_channel Ank_2 Ank_4 Ank_5 Ank Ank_3
Other DBs
NCBI-ProteinID: EDS45746
VectorBase: CPIJ005741
UniProt: B0WEN0
AA seq 1295 aa
MSNEKKDPGGVGLQIEAPSPVPSNSILTMPIGNINLPVPLSLEEKKYLLAVERGDLATVK
RILQRAHRKHHINVNCVDSLGRGALTLAIDGENLEMVEMLVIMQVETKDALLLAINAEFV
EAVELLLEHEELIHKEGEPYSWQKVDINTAMFTPDVTPLMLAAHKNNYEILKILLDRGAT
LPMPHDVKCGCDECIRRSSEDSLRHSLARVNEYRALASPSLIALSSQDPLLTAFQLSWEL
RNLAFAEQECKSEYLELRRQCQTFAVDLLDQSRSSQELAIILNYDPESPPYMDGDHMKLT
RLELAIDYKQKKFVAHPNIQQLLAAMWYEGVPGFRRKSALDKIAIITKVAVLFPLYCMLY
MIAPTCETSKFMRKPFMKFLIHASSYLFFLFLLILVSQRAEVQVVLLFGTESMKRALQEE
LARQRGNGPTYLECLVVIYVIGFIWEETQEIFAEGIQSYLKNMWNFIDFSRNFLYCCVVL
LRVIAYIQQTSEVNKDPSTAYIARENWDDFDPQLIAEGLFAAANIFSALKLVHLFSINPH
LGPLQISLGRMVIDIVKFFFIYSLVLFAFACGLNQLLWYFADLEKSKCYSLKGGLPDWDN
QGDACMKWRRFGNLFESSQSLFWASFGMVGLESFELQGIKSYTRFWGLLMFGSYSVINVI
VLLNLLIAMMSNSYAMIEQHSDTEWKFARTRLWMSYFEESSTLPPPFNIFPTMKHLLRIF
GKKKKRDIKRESTIRRKEDKERAERYTNVMRALVWRYVSAMHRRMEESAVTEDDINEVKG
EISAMRYELLEIFEKNGMDVSAADRKEKTVLAKRMKVWERRLMKDFQVAPIDVQNELAEE
DEEAQEDANPLAKFRRVAKKVATQTASAKWGQVMSGVGIETNSQIGRCRNRDSFKQQQQL
QKAMHEARRLVERSPLPRSRSASPSINGYADETTNTLAMLINQLAEETGGSVDSPYATLR
PDDHGQRSVTPLDLLTAQLQVALSKNPSPMMMRGSPKPGDKSPANKAGTRSPAPPTMASI
VGSSPTSPEPCNDKKITSLDVRSPPKVMSPPPAKNPPMSPPPAIHVTSDIPHPFKKAGSK
DSFDSIPSVEIKGPTPAPSKPASPAKAKSPPPPQPSAPVVAADQPAATVVHADDPSPLVS
GVNSPPKVVKRKSAAPAAPESSSDISVSRPVASKPQPGQGMIPPPPSKEEPALVIPTLST
TPATPLPVPKNLGAIPKTPQSPPVKAKSPSPPPPPAFKVDTMADQQLPSDVNSSLEQLVP
AGTVETAPPSPTCLRPINKIEDVKTIKRQPKSGWL
NT seq 3888 nt   +upstreamnt  +downstreamnt
atgtccaacgagaagaaagatcccggaggggtcggcctccagatcgaggcaccctcgccg
gtaccctccaactccatcctgaccatgcccatcggcaacatcaacctgcccgtgccgctg
tccctggaggagaaaaagtatctgctggcggttgagcgaggcgatcttgccacggtgaag
agaatcctccagcgtgcccaccggaagcatcacatcaacgtgaactgcgtggactcactg
ggtcgtggtgcgctcaccttggcgatcgacggcgagaacctggaaatggtcgagatgttg
gtgatcatgcaggtcgagaccaaggacgcactgctgttagccatcaacgccgagtttgtg
gaagctgtagagctgttgctggagcacgaagaattgatccacaaggaaggggaaccttac
agctggcaaaaggtcgatatcaacacggccatgtttacaccggacgtgacgccgctgatg
ttggcggctcacaagaacaactatgaaatcttgaagattctgctcgatcgtggagcgact
cttccgatgccccacgatgtcaagtgcggttgtgatgagtgtatccgtcgatcgtcggag
gattcgctgcgtcactcgttggctcgtgtcaatgagtaccgtgcgttggcaagtccgtca
ttgatcgcgctcagttcgcaggatccactgctgacggctttccagctgtcttgggagttg
cgtaacttggcctttgctgaacaggagtgcaaatcggaatatctggagttgcgtcggcag
tgtcagacgtttgccgtggatttgctggatcagtcgcgtagctcgcaggagttggccatc
attttgaactatgacccggagtcgccgccgtacatggatggtgatcatatgaaactgact
cggttggagcttgcgattgactacaaacagaagaaatttgtcgctcatccgaacatccag
caactgttggccgccatgtggtacgagggagttcccggattccgtcgcaagtctgcgctg
gacaagatcgcgatcatcaccaaagtggccgtcctgttcccgctgtactgtatgctctac
atgatcgcgccgacctgtgaaacgtccaagtttatgcgaaaaccgttcatgaagttcttg
atccatgcgtcgtcgtatttgttcttcctgtttctgttgatattggtgtcccagcgagct
gaagttcaggtggttctactgtttggtacggagagtatgaaacgagccctacaggaagag
ttggcccgccagcgaggcaacggtccaacgtatctcgagtgcctcgtggtcatctacgtg
atcggattcatctgggaggaaactcaggagatcttcgccgaaggcatccagagctacctg
aagaacatgtggaactttatcgacttttcgcgaaatttcctgtactgctgcgtggtttta
cttcgagtgatcgcgtacattcagcagacgtcggaggttaacaaggacccgagtacggcg
tacattgcacgtgagaactgggacgactttgacccccagctgatcgcggaaggtctgttc
gcggcggccaacatcttctcggccctgaaactggtccatctgttttcgatcaacccgcat
ctcggaccgctgcagatctcgctcggtcgcatggtcatcgatatcgtcaagttcttcttt
atctactctttggtactgtttgcattcgcttgtggtctgaaccaactgctctggtacttt
gccgacctggaaaagtcaaagtgctacagcttgaagggaggactaccggattgggacaac
caaggggacgcctgcatgaagtggagacgtttcggaaacctcttcgagtcgtcgcagtca
ctgttctgggccagcttcggcatggtcgggctggagagcttcgagctgcagggcatcaag
tcgtacacgcgcttctggggtctgctcatgtttggttcgtacagcgtgatcaacgtgatt
gtgctgttgaacctcctcatcgctatgatgtccaactcgtacgccatgatcgagcaacac
tcggacaccgagtggaagtttgcccggacgcgcctctggatgagctactttgaggagagt
tcgacgctgccgccacccttcaacatcttcccgaccatgaagcacctgctgcggatcttt
ggaaagaagaagaagcgcgacatcaagcgcgagtcgaccatccgccgcaaggaggacaag
gagcgggccgagcgttacacgaacgttatgcgggcgctggtgtggcgttacgtgtcggcc
atgcaccgccgcatggaggagagtgccgttacggaggacgatatcaacgaggtcaagggt
gaaatctccgccatgcggtacgagctgctggagatcttcgagaagaatggcatggatgtg
tcggcggccgatcgcaaggagaagactgtcctggcgaagcgcatgaaggtttgggagcgt
cgcctgatgaaggacttccaggtggccccgatagacgtgcagaacgaattggccgaagag
gacgaggaagcgcaagaggacgccaatccgttggccaagttccgacgcgtggcgaagaag
gtcgcaacccaaacagcctcggccaagtggggccaggtcatgtccggggtaggaatagaa
accaactcgcagattggtcgatgtcgcaaccgggacagcttcaagcagcaacagcagctc
cagaaggccatgcacgaggcacgccggttggttgagcgaagtccgttgccacgatcccga
agtgcttcaccgtcgatcaacggatacgcggacgagacgaccaacacgttggcgatgctg
atcaaccagttggccgaggaaactggaggctccgtcgattctccgtatgccaccctgaga
ccggatgaccatggtcaacgttccgttaccccgttggatctgctgaccgctcagctgcag
gttgctctcagcaagaacccttcgccgatgatgatgagaggatcgccgaaaccaggagat
aaatctccggccaacaaggccggtacccgttctccagctccaccaacgatggcttcaatt
gttggcagttcgccaacatctccggaaccgtgcaacgataaaaagattacttcccttgat
gtgagatccccaccaaaggtcatgtcacctcccccagctaagaatcctccaatgtcccca
ccaccggccattcacgtgacttccgacatacctcaccccttcaagaaggccggttccaag
gacagtttcgattctattccctcggttgagatcaagggcccaactccggccccatccaaa
ccagcttccccggcaaaggctaaatctccaccacctcctcaaccctcggccccggtcgtc
gctgccgatcaaccggcggccaccgttgtccatgccgacgatccgtcaccactcgtctca
ggtgtcaactcaccgccgaaggtcgtcaaacgtaagtcggctgccccagcagcccccgaa
tcctccagcgacatctcggtgtcccgcccggtggccagtaaaccacaacccggccaagga
atgatcccaccaccaccctctaaagaggaaccagccctcgtgatcccaaccctatcaacc
accccagctacacccctgcccgtccccaaaaacctgggagcgatcccaaagaccccacaa
tccccgccagtaaaggctaaatctccgtcgccgccgccgccaccggccttcaaggtggac
acgatggccgaccagcagctaccgtcggacgtcaactccagcttggagcagctcgtgccg
gccggaacagtggagaccgctccgccgtcgccgacgtgcctccgtcccataaacaagatt
gaggacgtgaagaccatcaagcggcaacccaagagcggatggctgtaa

DBGET integrated database retrieval system