KEGG   Chlorocebus sabaeus (green monkey): 103237547
Entry
103237547         CDS       T04361                                 

Gene name
CYP11B2
Definition
(RefSeq) cytochrome P450 family 11 subfamily B member 2
  KO
K07433  steroid 11beta-monooxygenase / corticosterone 18-monooxygenase [EC:1.14.15.4 1.14.15.5]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00140  Steroid hormone biosynthesis
csab01100  Metabolic pathways
csab04925  Aldosterone synthesis and secretion
Module
csab_M00108  C21-Steroid hormone biosynthesis, progesterone => corticosterone/aldosterone
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    103237547 (CYP11B2)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    103237547 (CYP11B2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:csab00199]
    103237547 (CYP11B2)
Enzymes [BR:csab01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.4  steroid 11beta-monooxygenase
     103237547 (CYP11B2)
    1.14.15.5  corticosterone 18-monooxygenase
     103237547 (CYP11B2)
Cytochrome P450 [BR:csab00199]
 Cytochrome P450, animal type
  CYP11 family
   103237547 (CYP11B2)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 103237547
NCBI-ProteinID: XP_007999900
Ensembl: ENSCSAG00000009165
Position
8
AA seq 503 aa
MALRAKAEVCMAAPWLSLQRAQALSTRAARAPSTVLPFEAIPQRPGSRWLRLLQIWREQG
YEHLHLEVHQTFQELGPIFRYHLGGPRMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYR
QHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALRNKVVQNA
RGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLSFLHALEVMFKSTVQLMFM
PRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELALSRPQQYTGIVAELLLNAELS
LEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQALRQESLAAAASISEHPQKATT
ELPLMRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNPALFPRP
ERYNPQRWLDIRGSGKNFHNVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQED
IKMVYSFILRPSTFPLLTFRAIN
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggcactcagggcaaaggcagaggtgtgcatggcagcaccctggctgtccctgcaaagg
gcacaggcactaagcaccagagccgcccgggcccctagtacggtgctgccctttgaagcc
ataccccagcgtccaggcagcaggtggctgaggttgctgcagatctggagggagcagggc
tatgagcacctgcacctggaggtgcaccagaccttccaggaactggggcccattttcagg
taccacttgggaggaccacgcatggtgtgtgtgatgcttccggaagacgtagagaagctg
cagcaggtggatagcctgcatccccacaggatgagcctggagccctgggtggcctacaga
caacatcgtgggcacaaatgtggcgtgttcttgctgaacgggcctgaatggcgcttcaat
agattgcggctgaacccagatgtgctgtcgcccaaggccgtgcagaggttcctcccgatg
gtggatgcagtggccagggacttctcccaggccctgaggaataaggtggtgcagaacgct
cgggggagcctgaccctggacgtccagcccagcatcttccactacaccatagaagccagc
aacttagctctttttggagagcggctgggcctggttggtcacagccccagctctgccagc
ctgagcttcctccatgccctggaggtcatgttcaaatccaccgtccagctcatgttcatg
cccaggagcctgtctcgctggaccagccccaaggtgtggaaggagcactttgaggcctgg
gactgcatcttccagtacggcgacaactgtatccagaaaatctaccaggaactggccttg
agccgccctcagcagtataccggcatcgtggcggaactcctgttgaatgcggaactgtcg
ctagaagccatcaaggccaactctatggaactcactgcagggagcgtggacacgacggcg
tttcccttgctgatgacactctttgagctggctcggaatcccgacgtgcagcaggccctg
cgccaggagagcctggccgccgccgccagcatcagtgaacatccccagaaggcaaccacc
gagctgcccttgatgcgggcggccctcaaggagaccttgaggctctaccctgtgggtctg
tttttggagcgagtggtgagctcagacttggtgcttcagaactaccacatcccagctggg
acactggtgcaggttttcctctactcactgggtcgcaatcccgccttgttcccgaggcct
gagcgctacaatccccagcgctggctagacatcaggggctctggaaagaacttccacaac
gtgccctttggctttggcatgcgccagtgcctggggcggcgcctggcagaagcggagatg
ctgctgctgctgcaccatgtgctgaaacacctccaggtggagacactaacccaagaggat
ataaagatggtctacagcttcatattgaggcccagcacgttccccctcctcaccttcagg
gccatcaattaa

DBGET integrated database retrieval system