KEGG   Caulobacter segnis: Cseg_2500
Entry
Cseg_2500         CDS       T01221                                 
Name
(GenBank) CagE, TrbE, VirB component of type IV transporter system, conserved region
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
cse  Caulobacter segnis
Pathway
cse02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cse00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Cseg_2500
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cse02044]
    Cseg_2500
Enzymes [BR:cse01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Cseg_2500
Secretion system [BR:cse02044]
 Type IV secretion system
  Trb secretion system protein
   Cseg_2500
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_22 TraG-D_C AAA_29 ABC_tran FtsK_SpoIIIE AAA_16 DUF87 AAA_7
Other DBs
NCBI-ProteinID: ADG10955
UniProt: D5VKD2
Position
complement(2732749..2735193)
AA seq 814 aa
MFDLREYRRRPSLLADYLPWVALVAPGVVLNKDGGFQRSAEFRGPDLDSATNAEVAAIAA
RLNGALRRLGSGWAIFVEARRDPAAAYPASVFPDPVSALVDAERRADFVDSGEHYESRFF
LTLSYLPPAERRGRLERLFVEGRAGDALDWRAELAAFIDRTDRFLALLDGLMPSCSWLGD
GETLGLLHGAVSTGRQRVAVPEIPIYLDSLLASQPLAGGLEPRLGGAHLRVLTIIGFPPA
TTPGLLDELNRLAFAYRWSTRALCLDKTQAVGALSKIRRQWFAKRKSVLALLREALTQEP
SALVDNDAANKAGEADLALQDLGGDAVAYAYVTTSLVVWDDDPAQADAKLALAEKVIQGR
ELTVIRESVNAVEGWLGTLPGHVYANVRQPPLSTLNLAHLAPLSAVWAGPARNAHLDGPP
LLIARTAGSTPFRLSLHVDDVGHTLVVGPTGAGKSVLLAMLALSFRRYPKAQLFAFDHGA
SSRAAVLAMGGAVHDLSGEAAAALSLQPLARIDLAEERAWASEWLAAILAREGVVMTPAV
RQHLWAALGSLSGAPVAERTLTGLVALLASPPLKAALAPFVLGGPHGRLLDGASERLREG
DLQVFETEGLARLAAAPAVLSYLFHRIERRLDGRPTLILIDEGWLALDDPAFGAQLREWL
KTLRKKKASVVFATQSLADVTQSAIAATIIESCPTRIFLPNPRALEPQGAAAYARFGLND
RQIEILARATPARDYYLQSRVGNRLFDLGLGPVALAFCAASAKADQALIGALLSRHGQAG
FAAAWLRAKRLAWAADLLPGGSAAPASLAPETSS
NT seq 2445 nt   +upstreamnt  +downstreamnt
gtgtttgaccttcgcgagtatcgccgccggccgagcctcttggccgactatctgccctgg
gtcgccttggtcgcgccgggcgtggtcttgaacaaggacggcggctttcagcgcagcgcg
gagtttcgggggcccgatctcgacagcgccaccaacgccgaggtcgccgccatcgccgcc
cggctgaacggggccttgcggcgcctgggctcgggctgggcgatcttcgtcgaggcaagg
cgcgatccggcggccgcctatccggccagcgtctttcccgatccggtctcggccctggtc
gacgcggagcggcgcgccgactttgtcgacagcggcgagcactatgagagccgcttcttc
ctgaccctcagctatttgccgccggccgagcggcgcggccggcttgagcgattgttcgtc
gaaggccgggccggcgacgcgctcgactggcgggcggaactggccgccttcatcgatcgc
accgaccggttcctggccttgctcgacggcctgatgccaagctgctcgtggctgggcgac
ggggagaccttgggcctgctgcacggggcggtctcgacgggccgccagcgcgtggcggtc
cccgagatcccgatctatctcgacagcctgctggccagccagcccctggccggcggtctc
gaaccaaggcttggcggcgcccacctgcgggtcctgacgatcatcggctttccgccggcc
acgacgccgggcctgctcgacgagctcaaccggctggccttcgcctatcgctggtcgacc
cgggcgctgtgcctggataagacgcaggccgtcggggctctgagcaagatccgccgccag
tggtttgccaagcgcaagtcggtgctggcgctgctgcgcgaggccctgacccaggagccc
tcggccctggtcgacaacgacgcggccaacaaggctggcgaggcggatctggccttgcag
gacctcggcggcgacgccgtcgcctacgcctatgtcaccaccagcctcgtggtctgggat
gacgaccccgcccaggccgacgccaagctcgccctggccgaaaaggtcatccagggccgc
gagctgacggtgatccgcgagagcgtcaacgccgtcgagggctggctgggcacgctgcct
ggacacgtctacgccaatgtccgccagccgccgctctcgaccctcaacctggcccacctg
gcgccgctgtcggcggtctgggccggaccggcgcgcaacgcccatctcgatggcccgccg
ctcttgatcgcccgcacggccggctccacgccctttcgcctcagcctgcatgtcgacgat
gtcggccacaccctggtcgtggggcccacgggcgcgggcaagagcgtccttctggccatg
ctggccctgtcgttccggcgctatcccaaggcccagctgtttgcttttgatcacggcgca
tccagccgcgcggccgttctggccatgggcggcgcggtccatgatctctcgggcgaagcc
gccgccgcgctcagcctgcagccgctggcgcgcatcgacctagccgaggagcgcgcctgg
gccagcgaatggctggcggcgatcctggcccgcgaaggcgtcgtcatgaccccggccgtg
cgccagcacctgtgggcggcgctgggcagtctctccggcgcgccggtggccgagcgcacc
ttgacggggctggtggcgctgctggccagcccgcccttgaaggccgcgctcgcgccgttc
gtgctgggggggccgcacggccgtctgctggatggcgcgagcgaacggttgagggagggc
gacctccaggtcttcgagaccgagggcctggcccgcctggcggccgcgccggcggtgctg
tcctatctcttccatcgcatcgaacggcgcctggatggtcggccgaccctgatcctgatc
gacgagggttggttggcgctcgatgatcctgcctttggcgcccagctgcgcgaatggctg
aaaaccctgcgcaagaagaaagcctcggtcgtcttcgccacccagtcgctggcggatgtc
acccagagcgccatcgccgcgacgatcatcgaaagctgtccgacccggatcttcctgccc
aatccgcgcgccctggagccgcagggcgcggccgcttacgctcggtttggcctcaacgac
cgccagatcgagatcctggcccgcgccaccccggcccgcgactactacctgcagtccagg
gtcgggaaccgcctgttcgatctggggcttgggcccgtggccctggccttctgcgccgcg
tccgccaaggccgaccaggccctgatcggcgcgctgctgtcccgccacggccaggcgggc
ttcgccgccgcctggctgcgcgccaagcgcctggcctgggccgccgacctcctgccgggc
ggatcggccgcccccgcaagcctcgccccggagacgtcgtcatga

DBGET integrated database retrieval system