KEGG   Chlorella variabilis: CHLNCDRAFT_137613Help
Entry
CHLNCDRAFT_137613 CDS       T02924                                 

Definition
(RefSeq) hypothetical protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
cvr  Chlorella variabilis
Pathway
cvr03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cvr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CHLNCDRAFT_137613
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cvr03041]
    CHLNCDRAFT_137613
Enzymes [BR:cvr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     CHLNCDRAFT_137613
Spliceosome [BR:cvr03041]
 Complex C
  Other components
   Step II factors
    CHLNCDRAFT_137613
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 S1 Helicase_C AAA_22 AAA_30 T2SSE AAA_19 DEAD Sigma54_activ_2 NB-ARC PhoH ABC_tran AAA_16 Transformer
Motif
Other DBs
NCBI-GeneID: 17358781
NCBI-ProteinID: XP_005851088
JGI: ChlNC64A_1_137613
UniProt: E1Z436
Position
Unknown
AA seq 1006 aa AA seqDB search
MEQLAKLQYLSLVSKITTELENHLGIADKTLSEFIVELSKGKASVKEFRLALRENGADMP
DSLVETLWAIIQRMLPGGKPGGKPGGGGAGPSGLQPRPDAPFAGLAMPDTRDRVKQMEEE
MLAEARAKAEADTGAERQRSHEQASTRNGREADGRGRGGREERNRDGPRYRSRSRSPGGG
GRRRRSRSRSRERYRRRSPSPRGGGGRREEPLPDEPEMYGVYRGRVTGVMDFGCFVELQG
FRTKQEGLVHLSNISSTKRAGSAKDMVGKGDPVWVKIVSKTGQRLGLAMRDVDQVTGEDL
LPMQRGAAPTGASNPAGPLSLANQTALHGLSGIKVKEDEVLEGKPKRRGKVMSDYEKWEI
KQLINSGVLDPSEYPGFDEEEGGALASVDAEVEEEFEIDLNDNEPDFLRGQTQKTGVEMS
PIKIVKNPDGSMQRAAMTQSALAKERRELREQQNRMLIEAIPKDLSKPWEDPMADASERA
LAQELRGIGVGVQEVPEWKQQALGKAPTFGIRDNRSIKDQRESLPIYKLREQLVQAVHDN
QVLVVIGETGSGKTTQMTQYLAESGYTSKGKIGCTQPRRVAAMSVAKRVSEEVGCRLGEE
VGYAIRFEDCTSQQTVIKYMTDGMLLREALLDDMLSQEEIDTSAQILFERMKSLGPAVPE
LIILPVYSALPSEMQTRIFEPAPPGTRKVVIATNIAEASLTIDGIYYVVDPGFAKQKVFN
PKRSNLSMTVLTMKAMGINDLLNFDFMDPPPPQTLISALEQLYNLGALDEEGLLTRLGRK
MAEFPLDPPVSKMLIASVDLGCSEEVLTIIGMLSAQNIFYRPKEKQAQADQKKAKFHQPE
GDHLTLLAVYEGWKNSKFSNPWCYEAFVQARSLRRAQDVRKQLVAIMDRYKLDLVSAGRS
YQKIQKAICSGFFFHAARKDAQEGYKTVVEQQPVFIHPSSALFQHQPQWVVYHELVLTTK
EYMREVCEIDPKWLVEMAPRFFRAADPHKLSRRKRHERIEPLKRRG
NT seq 3021 nt NT seq  +upstreamnt  +downstreamnt
atggagcagctggcgaagctgcagtacctgtcgctggtcagcaagatcaccacagagctc
gagaaccacttgggcattgcggacaagaccctgtctgagtttatcgtcgagctgagcaag
ggcaaggcgagcgtcaaggagttccggcttgcgctgcgcgagaatggcgccgacatgccc
gactcgctcgttgagactctgtgggccatcatccagcgcatgctgcccggcggcaagccc
ggcggcaagcccggcggcggcggggcggggccctcgggcctgcagccgcggccggatgca
ccgtttgcgggccttgcgatgcccgacactcgggaccgagtgaagcagatggaagaagag
atgctggcggaggctcgggccaaggcagaggcggatacaggggcagagcgtcagcgcagc
cacgagcaggcgtcgacgcgcaacgggcgggaggcggacggccggggccggggggggcgg
gaggagcggaaccgcgatggcccgcggtatcgcagcaggagccgcagccccggcggcggc
ggcaggcgccggcgcagccgcagcaggtcgagggagcggtatcggcgacgcagccccagc
ccgcgcggcggcggcggccgccgcgaggagccgctgccggatgagcctgagatgtatggc
gtgtaccggggccgtgtgacgggtgtcatggactttggctgctttgtggagctgcaaggg
ttccgcaccaagcaggaggggctggtgcacctgtccaatatctcctccaccaagcgggca
ggcagcgccaaggacatggtgggcaaaggcgaccccgtctgggtcaagattgtgtccaag
acgggccagcggctggggctggcgatgcgggatgtggatcaagtcacaggggaggacctg
ctgcccatgcagcgcggcgcggcccccaccggcgcctccaaccccgcgggcccgctcagc
ctggccaaccagaccgcgctgcacgggctgtcggggatcaaggtcaaggaggatgaggtg
ctggagggcaagcccaagcggcgcggcaaggtgatgagcgactacgagaagtgggagatc
aagcagctgatcaactcgggcgtgctggatcccagcgagtatcccggcttcgatgaggag
gagggcggcgcgctggcaagcgtggatgctgaggtggaggaggagtttgagatcgacctg
aacgacaacgagcccgacttcctgcggggccagacccagaagacgggggtggagatgagc
cccatcaagattgtgaagaacccagacggctccatgcagcgcgccgccatgacgcagagc
gctctggccaaggagcggcgggagctgcgggagcagcagaaccgcatgctgatcgaggcc
atccccaaggacctctccaagccctgggaggatcccatggcggacgccagcgagcgtgcg
ctggcgcaggagctgcgcggcatcggtgtgggggtgcaggaggtgccggagtggaagcag
caggcgctgggcaaggcgcccacctttggcatccgcgacaaccgctccatcaaggaccag
cgcgagtcgctgcccatctataagctgagggagcagctggtgcaggcggtgcacgacaac
caggttctggtggtgattggggagacggggtcaggcaagaccacccagatgacgcagtac
ctggcggagtcggggtacaccagcaagggcaagattggttgcacgcagcccaggcgtgtg
gccgccatgtctgtcgccaagcgcgtgtcggaggaagtggggtgccgcctgggagaggag
gtgggctacgccatccgcttcgaggactgcaccagccagcagacggtgatcaagtacatg
actgacggcatgctgctgcgggaggcgctcctggacgacatgctcagccaggaggagatt
gacaccagcgcccagatcctttttgagcgcatgaagtcgctgggacccgcggtgcccgag
ctcatcatcctgcccgtctactcggcgctgccctcggagatgcagacccgcatcttcgag
cccgccccgcccggcacccgcaaggtggtcatcgccaccaacatcgccgaggcctccctc
accatcgacggcatctactacgtggtggaccccggcttcgccaagcagaaggtgttcaac
ccaaagcgctccaacctgtccatgacggtgctgaccatgaaggcgatgggcatcaacgac
ctgctcaacttcgacttcatggacccgccgccgccgcagaccctcatctccgccctggag
cagctgtacaacctgggagcgctggacgaggaggggctgctgacgcggctgggccgcaag
atggcggagttcccgctggacccgcccgtcagcaagatgctgatcgccagcgtggacctg
gggtgcagcgaggaggtgctgaccatcatcggcatgctctccgcgcaaaacatcttctac
cggcccaaggagaagcaggcgcaggctgaccagaagaaggccaagttccaccagcccgag
ggcgaccacctcacgctgctggcggtctacgagggctggaagaactccaagttctccaac
ccctggtgctacgaggcctttgtgcaggcgcggtcgctgcggcgggcgcaggatgtgcgc
aagcagctggtggccatcatggatcgctacaagctcgacctggtgtcagccgggcgcagc
taccagaagatccagaaggccatctgctccggcttcttcttccacgccgcccgcaaggac
gcgcaggagggctacaagacggtggtggagcagcagcccgtgttcatccaccccagctcc
gccctcttccagcaccagccgcagtgggtggtgtaccacgagctggtgctgacaacaaag
gagtacatgcgagaggtgtgcgagatcgaccccaagtggctggtggagatggcgccgcgc
ttcttccgcgccgctgacccgcacaagctctcgaggcgcaagcggcacgagcgcatcgag
ccccttaaacggcgcggctaa

DBGET integrated database retrieval system