KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6713
Entry
Dmel_CG6713       CDS       T00030                                 

Gene name
Nos
Definition
(RefSeq) nitric oxide synthase, isoform A
  KO
K13240  nitric-oxide synthase, brain [EC:1.14.13.39]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00220  Arginine biosynthesis
dme00330  Arginine and proline metabolism
dme01100  Metabolic pathways
dme04145  Phagosome
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Dmel_CG6713 (Nos)
   00330 Arginine and proline metabolism
    Dmel_CG6713 (Nos)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    Dmel_CG6713 (Nos)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     Dmel_CG6713 (Nos)
SSDB
Motif
Pfam: NO_synthase Flavodoxin_1 FAD_binding_1 NAD_binding_1 TFIIA DUF2722 Flavodoxin_5 Spt20
Other DBs
NCBI-GeneID: 34495
NCBI-ProteinID: NP_523541
FlyBase: FBgn0011676
UniProt: Q27571
Position
2L
AA seq 1349 aa
MSQHFTSIFENLRFVTIKRSTNAQQQQQQQQQQLQQQQQQLQQQKAQTQQQNSRKIKTQA
TPTLNGNGLLSGNPNGGGGDSSPSHEVDHPGGAQGAQAAGGLPSSSGTPLRHHKRASIST
ASPPIRERRGTNTSIVVELDGSGSGSGSGGGGVGVGQGAGCPPSGSCTASGKSSRELSPS
PKNQQQPRKMSQDYRSRAGSFMHLDDEGRSLLMRKPMRLKNIEGRPEVYDTLHCKGREIL
SCSKATCTSSIMNIGNAAVEARKSDLILEHAKDFLEQYFTSIKRTSSTAHETRWKQVRQS
IETTGHYQLTETELIYGAKLAWRNSSRCIGRIQWSKLQVFDCRYVTTTSGMFEAICNHIK
YATNKGNLRSAITIFPQRTDAKHDYRIWNNQLISYAGYKQADGKIIGDPMNVEFTEVCTK
LGWKSKGSEWDILPLVVSANGHDPDYFDYPPELILEVPLTHPKFEWFSDLGLRWYALPAV
SSMLFDVGGIQFTATTFSGWYMSTEIGSRNLCDTNRRNMLETVALKMQLDTRTPTSLWKD
KAVVEMNIAVLHSYQSRNVTIVDHHTASESFMKHFENESKLRNGCPADWIWIVPPLSGSI
TPVFHQEMALYYLKPSFEYQDPAWRTHVWKKGRGESKGKKPRRKFNFKQIARAVKFTSKL
FGRALSKRIKATVLYATETGKSEQYAKQLCELLGHAFNAQIYCMSDYDISSIEHEALLIV
VASTFGNGDPPENGELFSQELYAMRVQESSEHGLQDSSIGSSKSFMKASSRQEFMKLPLQ
QVKRIDRWDSLRGSTSDTFTEETFGPLSNVRFAVFALGSSAYPNFCAFGQYVDNILGELG
GERLLRVAYGDEMCGQEQSFRKWAPEVFKLACETFCLDPEESLSDASLALQNDSLTVNTV
RLVPSANKGSLDSSLSKYHNKKVHCCKAKAKPHNLTRLSEGAKTTMLLEICAPGLEYEPG
DHVGIFPANRTELVDGLLNRLVGVDNPDEVLQLQLLKEKQTSNGIFKCWEPHDKIPPDTL
RNLLARFFDLTTPPSRQLLTLLAGFCEDTADKERLELLVNDSSAYEDWRHWRLPHLLDVL
EEFPSCRPPAPLLLAQLTPLQPRFYSISSSPRRVSDEIHLTVAIVKYRCEDGQGDERYGV
CSNYLSGLRADDELFMFVRSALGFHLPSDRSRPIILIGPGTGIAPFRSFWQEFQVLSDLD
PTAKLPKMWLFFGCRNRDVDLYAEEKAELQKDQILDRVFLALSREQAIPKTYVQDLIEQE
FDSLYQLIVQERGHIYVCGDVTMAEHVYQTIRKCIAGKEQKSEAEVETFLLTLRDESRYH
EDIFGITLRTAEIHTKSRATARIRMASQP
NT seq 4050 nt   +upstreamnt  +downstreamnt
atgtcgcagcatttcacatcgatatttgagaacctgcgattcgtgaccatcaaacgttcg
acaaatgcgcaacagcaacagcagcagcagcaacagcaactgcagcagcagcagcagcag
ctgcagcaacagaaggcacagacacagcaacaaaatagcagaaaaatcaaaactcaagca
acgccaacgttgaatggcaatgggctcttgagcggcaatccaaatggcggaggcggtgac
tcctcgcccagccatgaagtggaccatccgggtggagcacaaggagctcaagcagcagga
ggcttgccatcttcaagtggcacgccattgaggcaccacaagcgcgccagtatctccaca
gcatcgcctccaatccgcgaacggcgtggcaccaacaccagcatcgtggtcgaactggat
ggcagtggcagcgggagtgggagtggcggtggtggcgttggcgttggtcagggtgcgggt
tgtcctccctcgggcagctgcactgcgtccggaaaaagttcgcgggaactatcgccgtcg
ccgaaaaaccaacagcagcccagaaagatgtcacaggattatcggtcgcgtgccggcagt
tttatgcacctggacgacgagggacgcagtctgctgatgcgcaagccgatgagactgaag
aacatcgagggcaggccggaggtctacgacacgctgcactgcaagggtcgcgagattctt
tcctgctcgaaggccacctgtacgagcagcattatgaacattggcaatgcggcggtggag
gccaggaaatccgatctgatcctcgaacacgccaaggacttcctcgagcagtactttaca
tcgataaagcgtacatcatctaccgcccacgagacgcgatggaaacaggtgcgccagagc
attgagaccactggacattatcagctaaccgaaacggaactaatttatggtgccaaattg
gcctggcgcaattcttcacgttgcattggccgaatacaatggtcgaagttgcaggtcttt
gactgtcggtatgtgacaacaacaagtggcatgtttgaagccatttgcaatcacattaaa
tatgcaacaaataagggcaacctgagatcggccatcacgatatttccacaacgcacagat
gccaagcatgattatcgcatttggaataaccaattaatatcttatgccggctacaagcag
gcggatgggaaaatcattggcgatcccatgaatgtggagtttacagaggtctgcaccaag
ctgggctggaagagcaagggcagcgagtgggacatactgccattggtggtctcggccaat
ggtcacgatccggactactttgattacccgcccgaattgatactggaagttccgctgacc
catccaaaattcgaatggttctcggatctgggactgcgatggtacgccctgcccgccgta
tccagtatgctgttcgatgtgggcggcattcagtttacggccaccacattcagtggttgg
tacatgtcgacagagattggcagccggaatttatgcgacacaaatcgccgcaatatgctg
gagacggtggcgctgaagatgcaactggacacccgtacgcccacatccttgtggaaggac
aaggctgtggtggagatgaacattgccgtgctccactcctaccagagtcgcaacgtgacc
attgtggatcaccacacggccagcgagagctttatgaagcatttcgagaacgagtccaag
ctcaggaatgggtgtcccgctgattggatttggatcgtgccgccgctgtcgggctccata
acgccggtattccatcaggagatggctctgtactacctgaagccctcgttcgagtaccag
gatcccgcctggcgaacccacgtgtggaagaaggggcgtggcgagagcaagggcaagaag
ccaagacgtaaattcaattttaaacaaatcgctagggctgtgaaatttacatcgaaacta
tttggacgcgccttatcgaaacgcataaaggcaacagttctatatgccaccgaaactggc
aaatcggagcaatatgcgaagcaactttgtgaactcctagggcacgcattcaatgcacag
atatattgcatgtccgactacgatatatcctccattgagcacgaggcattgttaattgtt
gtggcctccacctttggcaacggtgatccgcccgaaaacggcgagcttttctcccaggaa
ttgtatgcgatgcgtgtccaggagtcttccgagcatggattgcaggactccagcattggc
tcgtcaaagtccttcatgaaggccagctcgcggcaggagttcatgaagctgccactgcaa
caggtgaagagaatcgaccgctgggactcgctgcggggctccacctcggacaccttcacc
gaggagacctttggccccctctccaatgtccggttcgccgtttttgccctcggctcctcg
gcctatccaaatttctgcgccttcggtcagtatgtggacaacattctgggcgagctgggc
ggcgaacgcctgctgagggtggcctacggcgacgagatgtgcggacaggagcagtcgttc
cggaagtgggcgcccgaggtattcaagttggcctgcgagaccttctgcctggatccagag
gagagcctttcggatgcctcgctagccctgcagaacgattcgctgactgtgaatacggtg
cgcctggtgccgtcggcgaataagggatccctggacagcagtttatccaagtaccacaac
aagaaggtgcactgctgcaaggcgaaggcgaagccccacaatttgacccgtttgagtgag
ggagccaagacaacgatgctgctggagatctgtgcacctggcttggagtacgagccgggt
gatcatgtgggcatctttccggcgaatcgaacggaactggtcgacggactgctaaatcga
ctggtgggtgtggataatcccgacgaggtgctgcagttgcaattgctaaaggaaaagcag
acatcgaatggtatattcaagtgctgggagccgcacgacaaaataccgccggatactcta
aggaatcttctggcccgattctttgatctgaccactccgccatcgcgacagttgctcacc
ctgctggcaggattctgtgaggataccgcggacaaggagcggctggagttgctggtcaac
gattcgtcggcctacgaggactggcggcactggcggctgccccatctgctggacgttctc
gaggagttcccctcgtgccgaccaccggctccccttctgcttgcccaactaacgccgctg
cagcctcgcttctattccatttcttcgtcgccgcgccgcgttagtgacgaaatccacctc
acggtggccatcgtgaagtaccgctgtgaagatggccagggagacgagcggtatggcgtg
tgctctaactatctatccggcttgcgggcagacgacgagctgttcatgttcgtgaggagc
gccttgggcttccatttgcccagcgatcggagtcgtcccattattctgattggtcctggc
acaggaatagctccattccgctccttttggcaggagttccaggtgctaagcgaccttgat
cccacggccaaattgcccaagatgtggctcttctttggctgccgtaatcgggatgtcgat
ttgtacgccgaggagaaggcagagctacagaaggatcaaatcctagaccgagtttttctc
gctctgtccagggagcaggccattccgaagacatatgtgcaggacctgattgagcaggaa
ttcgattcgttgtaccagttgattgtccaggagcggggccacatctacgtctgcggcgat
gtcacaatggccgagcatgtgtaccagaccatcaggaagtgcattgccggcaaagagcag
aaaagcgaggcggaagttgagacatttttgctaacactgcgggacgaaagtcgctaccac
gaggacatctttggcatcacgctgcgaacggctgagatacacacaaagtcaagggccacg
gccaggatacgaatggcctcccagccataa

DBGET integrated database retrieval system