KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7875
Entry
Dmel_CG7875       CDS       T00030                                 

Symbol
trp
Name
(RefSeq) transient receptor potential, isoform A
  KO
K04967  transient receptor potential cation channel subfamily C member 4
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04745  Phototransduction - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09150 Organismal Systems
  09157 Sensory system
   04745 Phototransduction - fly
    Dmel_CG7875 (trp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dme04040]
    Dmel_CG7875 (trp)
Ion channels [BR:dme04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   Dmel_CG7875 (trp)
SSDB
Motif
Pfam: Ion_trans TRP_2 Ank_2 PKD_channel Ank_5 Ank_4 Ank_3 Ank
Other DBs
NCBI-GeneID: 43542
NCBI-ProteinID: NP_476768
FlyBase: FBgn0003861
UniProt: P19334 U3PXB8
Position
3R
AA seq 1275 aa
MGSNTESDAEKALGSRLDYDLMMAEEYILSDVEKNFILSCERGDLPGVKKILEEYQGTDK
FNINCTDPMNRSALISAIENENFDLMVILLEHNIEVGDALLHAISEEYVEAVEELLQWEE
TNHKEGQPYSWEAVDRSKSTFTVDITPLILAAHRNNYEILKILLDRGATLPMPHDVKCGC
DECVTSQMTDSLRHSQSRINAYRALSASSLIALSSRDPVLTAFQLSWELKRLQAMESEFR
AEYTEMRQMVQDFGTSLLDHARTSMELEVMLNFNHEPSHDIWCLGQRQTLERLKLAIRYK
QKTFVAHPNVQQLLAAIWYDGLPGFRRKQASQQLMDVVKLGCSFPIYSLKYILAPDSEGA
KFMRKPFVKFITHSCSYMFFLMLLGAASLRVVQITFELLAFPWMLTMLEDWRKHERGSLP
GPIELAIITYIMALIFEELKSLYSDGLFEYIMDLWNIVDYISNMFYVTWILCRATAWVIV
HRDLWFRGIDPYFPREHWHPFDPMLLSEGAFAAGMVFSYLKLVHIFSINPHLGPLQVSLG
RMIIDIIKFFFIYTLVLFAFGCGLNQLLWYYAELEKNKCYHLHPDVADFDDQEKACTIWR
RFSNLFETSQSLFWASFGLVDLVSFDLAGIKSFTRFWALLMFGSYSVINIIVLLNMLIAM
MSNSYQIISERADTEWKFARSQLWMSYFEDGGTIPPPFNLCPNMKMLRKTLGRKRPSRTK
SFMRKSMERAQTLHDKVMKLLVRRYITAEQRRRDDYGITEDDIIEVRQDISSLRFELLEI
FTNNNWDVPDIEKKSQGVARTTKGKVMERRILKDFQIGFVENLKQEMSESESGRDIFSSL
AKVIGRKKTQKGDKDWNAIARKNTFASDPIGSKRSSMQRHSQRSLRRKIIEQANEGLQMN
QTQLIEFNPNLGDVTRATRVAYVKFMRKKMAADEVSLADDEGAPNGEGEKKPLDASGSKK
SITSGGTGGGASMLAAAALRASVKNVDEKSGADGKPGTMGKPTDDKKAGDDKDKQQPPKD
SKPSAGGPKPGDQKPTPGAGAPKPQAAGTISKPGESQKKDAPAPPTKPGDTKPAAPKPGE
SAKPEAAAKKEESSKTEASKPAATNGAAKSAAPSAPSDAKPDSKLKPGAAGAPEATKATN
GASKPDEKKSGPEEPKKAAGDSKPGDDAKDKDKKPGDDKDKKPGDDKDKKPADNNDKKPA
DDKDKKPGDDKDKKPGDDKDKKPSDDKDKKPADDKDKKPAAAPLKPAIKVGQSSAAAGGE
RGKSTVTGRMISGWL
NT seq 3828 nt   +upstreamnt  +downstreamnt
atgggcagcaatacggaatccgatgccgagaaggcgttggggtctcgcctggattacgac
ctgatgatggccgaggagtacatcctcagcgatgtggagaagaatttcatattgtcctgc
gagcggggtgacttgccaggtgtcaagaagatcctcgaggagtaccagggcacggacaag
ttcaacattaactgcacggatcccatgaaccgctccgccctcatttcggccatcgagaac
gagaacttcgacctgatggtgatcctgctggagcataacatcgaggtgggcgacgccctg
ttgcacgccatctcggaggagtatgtggaggcggtggaggagctgctgcagtgggaggag
accaaccacaaggagggccagccatacagctgggaggcggtggaccgctccaagtccacc
ttcaccgtggacatcacgccccttatcctggccgcccaccgaaataactacgagatactc
aaaatcctcctggatcgcggggccacgctgcccatgccgcacgacgtcaagtgcggctgc
gatgagtgtgtgacctcccagatgacggactccctgcgccactcgcagtcgaggatcaac
gcataccgcgccctgtccgccagctcgctgatagcgctcagctcccgggaccctgtactg
accgccttccaattgtcctgggaactcaagcgcctgcaggcgatggaatcggagtttcgt
gccgaatacacggagatgcgtcagatggtgcaggacttcgggacctcgctcctggatcac
gcacgcacatccatggaactcgaggtgatgctcaacttcaaccacgagccgtcccacgac
atctggtgccttggccagcggcaaaccctggaacgactgaagctggccattcgctataag
caaaaaacgtttgtggcacatccaaatgtccaacaattgttggccgccatttggtacgac
ggactgccgggcttccggcgcaagcaggcctcccagcagctgatggatgtcgtgaagctg
ggatgcagcttccccatctacagcttgaagtacatcctggccccggattccgagggtgcc
aagttcatgcgcaagccctttgtcaagttcatcacgcactcctgctcctacatgttcttc
ctgatgctcctgggtgctgcctccctgagggtggtgcaaatcacctttgaactcctcgca
tttccctggatgctgaccatgctggaggattggcgcaaacacgagagaggttcactaccg
ggtcccattgaactggcaatcattacctacataatggctctaatatttgaggaactgaaa
tctttatattcggacggcttgtttgagtacatcatggatctttggaacatagtggactac
atatcgaacatgttctatgtgacgtggattctttgtagggccaccgcttgggtaatcgtc
catcgtgatctctggttccggggcatagatccttacttcccaagggaacactggcatccg
tttgatccaatgcttctatcagagggcgcctttgctgccggaatggtcttctcctatcta
aagctcgtccacatcttctccattaatccccacctgggacccttgcaagtttcactgggt
cgcatgataatcgacatcatcaagttcttcttcatctacacactggtgttgtttgccttc
ggatgtggtctcaaccagttgctatggtactacgctgagctggagaagaacaagtgctat
cacctgcatcccgatgtggctgactttgatgaccaggagaaggcttgtaccatctggcga
agattttccaacttattcgaaacatcacaatcgctcttttgggcctcttttggcctggtg
gacctggtctccttcgatctggcgggaatcaagagcttcacccgcttctgggcactgcta
atgttcggctcctattcggttatcaacatcattgtgcttctcaacatgctgattgccatg
atgtccaactcctaccaaatcatctcggagcgagccgacactgagtggaagttcgcccga
tcccagctgtggatgagctacttcgaggatggcggcaccattccaccgcccttcaacctc
tgtcccaacatgaagatgttgaggaagaccctgggccgaaagcgaccgtcacgaaccaag
agcttcatgcgaaagtccatggaacgggcacagacgctgcatgacaaagtgatgaagctg
ctggtcaggaggtacattacggcggagcagaggcggcgggacgattacggcattaccgag
gatgatatcattgaggtgcgccaggacatcagctccttgcggttcgagttgctggagatt
ttcaccaacaataactgggatgtacccgacattgagaagaagtcgcagggagttgctcga
accaccaagggcaaggtgatggaacgtcgcatccttaaggacttccaaatcggcttcgtc
gagaatctgaagcaggaaatgagcgaatctgagagcggacgagatatattctcatcgctg
gccaaggtcatcggcagaaagaagacccagaagggagacaaggattggaacgccattgcg
aggaagaatactttcgcctccgatcccattggctccaagcgctcctccatgcaacgtcat
agccagcgaagcttgaggaggaagatcatcgagcaggcgaatgagggtcttcagatgaac
cagacccagttgattgaattcaatcccaacttgggtgatgtgacgcgtgccacaagagtg
gcttatgtcaagttcatgcggaagaagatggctgccgacgaggtttccttggccgatgac
gagggtgctccaaatggcgaaggcgaaaagaagccactggatgcctctgggtctaaaaag
tccataactagtggtggaactggaggaggagcttctatgttggctgcagctgctctaaga
gcatcggttaagaatgtggatgaaaaatccggagccgatggcaagcccggcacgatgggc
aagccaacggatgacaagaaagcaggtgatgataaggataagcagcagcctcccaaggac
tccaagccgtcagcaggtggtcccaagcccggggatcagaagccaactccgggtgcggga
gctccaaagccccaagcagctggcactatcagcaagcccggtgagtcacaaaagaaggac
gctccggcaccaccaaccaaacctggagacaccaagcctgctgcgccgaagcctggagaa
tccgccaagcccgaggccgctgccaaaaaggaggagtcttccaagaccgaagctagcaag
ccggcagccacaaatggagcagccaagagcgcagctccctccgctccttcggatgccaag
ccggattccaaactgaaacctggagcagctggagcaccagaagcaactaaggcaaccaat
ggggcctccaagccggacgaaaagaagagcggtccggaggagccaaaaaaggctgcagga
gactccaagccaggagacgatgccaaggacaaggataagaaacccggcgacgataaggac
aagaaacctggcgacgacaaagacaagaaacctgctgacaataatgataagaagccagcc
gatgacaaggacaagaagccgggagacgataaggacaagaagccgggtgacgacaaggac
aagaagccgagcgatgataaggacaagaagcctgccgatgacaaggacaagaagccagca
gcagctcctctgaagccggcgatcaaggtgggtcagagcagtgccgcagctggcggagaa
cgaggcaaatccacggtcacaggacgcatgatctccggctggctctaa

DBGET integrated database retrieval system