KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9375
Entry
Dmel_CG9375       CDS       T00030                                 

Gene name
Ras85D
Definition
(RefSeq) Ras oncogene at 85D
  KO
K07827  GTPase KRas
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04068  FoxO signaling pathway
dme04137  Mitophagy - animal
dme04140  Autophagy - animal
dme04150  mTOR signaling pathway
dme04213  Longevity regulating pathway - multiple species
dme04214  Apoptosis - fly
dme04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG9375 (Ras85D)
   04068 FoxO signaling pathway
    Dmel_CG9375 (Ras85D)
   04150 mTOR signaling pathway
    Dmel_CG9375 (Ras85D)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Dmel_CG9375 (Ras85D)
   04137 Mitophagy - animal
    Dmel_CG9375 (Ras85D)
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmel_CG9375 (Ras85D)
 09150 Organismal Systems
  09158 Development and regeneration
   04320 Dorso-ventral axis formation
    Dmel_CG9375 (Ras85D)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dmel_CG9375 (Ras85D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG9375 (Ras85D)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:dme04031]
    Dmel_CG9375 (Ras85D)
Membrane trafficking [BR:dme04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    Dmel_CG9375 (Ras85D)
GTP-binding proteins [BR:dme04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    Dmel_CG9375 (Ras85D)
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Gtr1_RagA Septin Aldo_ket_red AAA_25 PHP_C
Other DBs
NCBI-GeneID: 41140
NCBI-ProteinID: NP_476699
FlyBase: FBgn0003205
UniProt: P08646
Position
3R
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDL
ASWNVNNEQAREVAKQYGIPYIETSAKTRMGVDDAFYTLVREIRKDKDNKGRRGRKMNKP
NRRFKCKML
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacggaatacaaactggtcgtcgttggagccggaggcgtgggcaagtccgcgctcacc
atccagctaatccagaaccatttcgtggacgagtacgaccccacaatcgaggactcttac
cgaaagcaagtggttatcgatggagagacctgcctgctggacatcctggacaccgccggc
caagaggagtactcggccatgcgggatcagtatatgcggactggcgagggattcctgctg
gtctttgccgtcaacagtgcgaagtccttcgaggatatcggcacctaccgtgagcagatc
aagcgcgtaaaggatgccgaagaggtgcccatggtgctggtgggcaacaaatgtgatctg
gcctcgtggaacgttaacaacgagcaggcaagagaggtggccaaacagtacggcattcca
tacattgagacatccgccaagacgcgcatgggcgtggacgatgcattttacacactggtg
cgcgaaatccgcaaggacaaggacaacaaggggcggaggggccgcaaaatgaacaagccg
aatcgtagatttaaatgtaaaatgctctaa

DBGET integrated database retrieval system