KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os01t0194300-01Help
Entry
Os01t0194300-01   CDS       T02163                                 

Gene name
Os01g0194300, NPR1_HOMOLOG_1, NH1
Definition
(RAP-DB) Similar to NPR1.
  KO
K14508  regulatory protein NPR1
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04075 Plant hormone signal transduction
    Os01t0194300-01 (Os01g0194300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dosa04121]
    Os01t0194300-01 (Os01g0194300)
Ubiquitin system [BR:dosa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     Os01t0194300-01 (Os01g0194300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NPR1_like_C DUF3420 Ank_2 Ank Ank_4 Ank_5 Ank_3 BTB
Motif
Other DBs
RAP-DB: Os01t0194300-01
Oryzabase: 7370
Position
chr01:complement(join(5064560..5065120,5062091..5062838,5061682..5061882,5060881..5061119))
AA seq 582 aa AA seqDB search
MEPPTSHVTNAFSDSDSASVEEGGADADADVEALRRLSDNLAAAFRSPEDFAFLADARIA
VPGGGGGGGDLLVHRCVLSARSPFLRGVFARRAAAAAGGGGEDGGERLELRELLGGGGEE
VEVGYEALRLVLDYLYSGRVGDLPKAACLCVDEDCAHVGCHPAVAFMAQVLFAASTFQVA
ELTNLFQRRLLDVLDKVEVDNLLLILSVANLCNKSCMKLLERCLDMVVRSNLDMITLEKS
LPPDVIKQIIDARLSLGLISPENKGFPNKHVRRIHRALDSDDVELVRMLLTEGQTNLDDA
FALHYAVEHCDSKITTELLDLALADVNHRNPRGYTVLHIAARRREPKIIVSLLTKGARPA
DVTFDGRKAVQISKRLTKQGDYFGVTEEGKPSPKDRLCIEILEQAERRDPQLGEASVSLA
MAGESLRGRLLYLENRVALARIMFPMEARVAMDIAQVDGTLEFNLGSGANPPPERQRTTV
DLNESPFIMKEEHLARMTALSKTVELGKRFFPRCSNVLDKIMDDETDPVSLGRDTSAEKR
KRFHDLQDVLQKAFHEDKEENDRSGLSSSSSSTSIGAIRPRR
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggagccgccgaccagccacgtcaccaacgcgttctccgactcggacagcgcgtccgtg
gaggaggggggcgccgacgcggacgccgacgtggaggcgctccgccgcctctccgacaac
ctcgccgcggcgttccgctcgcccgaggacttcgcgttcctcgccgacgcgcgcatcgcc
gtcccgggcggcggcggcggcggcggcgacctgctggtgcaccgctgcgtgctctccgcg
cggagccccttcctgcgcggcgtcttcgcgcgccgcgccgccgccgccgcaggcggcggc
ggcgaggatggcggcgagaggctggagctccgggaactcctcggcggcggcggcgaggag
gtggaggtcgggtacgaggcgctgcggctggtgctcgactacctctacagcggccgcgtc
ggcgacctgcccaaggcggcgtgcctctgcgtcgacgaggactgcgcccacgtcgggtgc
caccccgccgtcgcgttcatggcgcaggtcctcttcgccgcctccaccttccaggtcgcc
gagctcaccaacctcttccagcggcgtctccttgatgtccttgataaggttgaggtagat
aaccttctattgatcttatctgttgccaacttatgcaacaaatcttgcatgaaactgctt
gaaagatgccttgatatggtagtccggtcaaaccttgacatgattactcttgagaagtca
ttgcctccagatgttatcaagcagattattgatgcacgcctaagcctcggattaatttca
ccagaaaacaagggatttcctaacaaacatgtgaggaggatacacagagcccttgactct
gacgatgtagagctagtcaggatgctgctcactgaaggacagacaaatcttgatgatgcg
tttgcactgcactacgccgtcgaacattgtgactccaaaattacaaccgagcttttggat
ctcgcacttgcagatgttaatcatagaaacccaagaggttatactgttcttcacattgct
gcgaggcgaagagagcctaaaatcattgtctcccttttaaccaagggggctcggccagca
gatgttacattcgatgggagaaaagcggttcaaatctcaaaaagactaacaaaacaaggg
gattactttggggttaccgaagaaggaaaaccttctccaaaagataggttatgtattgaa
atactggagcaagctgaaagaagggacccacaactcggagaagcatcagtttctcttgca
atggcaggtgagagtctacgaggaaggttgctgtatcttgaaaaccgagttgctttggcg
aggattatgtttccgatggaggcaagagtagcaatggatattgctcaagtggatggaact
ttggaatttaacctgggttctggtgcaaatccacctcctgaaagacaacggacaactgtt
gatctaaatgaaagtcctttcataatgaaagaagaacacttagctcggatgacggcactc
tccaaaacagtggagctcgggaaacgctttttcccgcgatgttcgaacgtgctcgacaag
atcatggatgatgaaactgatccggtttccctcggaagagacacgtccgcggagaagagg
aagaggtttcatgacctgcaggatgttcttcagaaggcattccacgaggacaaggaggag
aatgacaggtcggggctctcgtcgtcgtcgtcatcgacatcgatcggggccattcgacca
aggagatga

DBGET integrated database retrieval system