KEGG   Danio rerio (zebrafish): 100333601
Entry
100333601         CDS       T01004                                 

Gene name
mmp25b
Definition
(RefSeq) matrix metalloproteinase-25-like
  KO
K08003  matrix metalloproteinase-25 (membrane-inserted) [EC:3.4.24.-]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dre01002]
    100333601 (mmp25b)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     100333601 (mmp25b)
Peptidases and inhibitors [BR:dre01002]
 Metallo peptidases
  Family M10
   100333601 (mmp25b)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Astacin Peptidase_M66 Reprolysin_4 IN_DBD_C DUF4953 Reprolysin_3 Reprolysin_5 Metallopep
Other DBs
NCBI-GeneID: 100333601
NCBI-ProteinID: XP_002663942
ZFIN: ZDB-GENE-100308-4
Ensembl: ENSDARG00000010556
UniProt: E7F1N5
Position
12
AA seq 573 aa
MSFSGYLGLVYLTCPMLVFFSAVHSAPVKDQYSRGVDWLSRYGYLPPLDPRTGQLQSKDG
IERAIREMQRFAGLKETGKLDSDTLTLMNTPRCSLPDIIGIEDKLKKRRRKRYATTGLRW
TKSDITWSVQNYPSVHKRLTPTQVDPIISYALKAWSDVTNLNFYGASSSEKDRADIRISF
ARSLHDDGYPFDGKGGTLAHAFFPGESDVAGDTHFDDDEIWTYLDESGTDLFAVAVHEFG
HALGLSHSSSSPSIMKPYYQGSVGDVGSYILPDDDREAIQSLYGRKISSPTPSPNKPTSH
LPKPPATYPKGPVKPDPSIQNRCEGGFDAVANLRGEVFFFKGPYFWRIQRTGSLVSFQPA
HIKNFWMGLPPTTNKVDAVYERKVDNAIIFFIGSQYWVFKNTEVLPGYPRPLSDWGMITQ
DGRKVMRVDAAFIWAHNGKTYIFSGGEFWRFSEGRETELRGPDTGYPRNTNLWKGAPSNP
DDVITWGQGDAYFFKDNSYWVLKNGEMDQTSVTKKSTAVDWMMCQQETTKAPESPRRREG
VNCYCDNSAGLQMSVSAWLLLITALLHIGFNSQ
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgagtttctcaggatatcttggtctggtttacctgacctgccctatgcttgtgttcttc
tctgcggttcattcggctccggtaaaggatcagtattctcggggtgtggactggttgagc
cggtatggatatctgcctcctctagacccgcgcacaggacagctacagagcaaagacggc
atcgagagagccattagagaaatgcagagattcgctggactcaaggaaacaggcaaactc
gacagtgacactctgacgctgatgaacacaccacgatgttctctgccagacatcataggc
attgaggacaagctgaaaaagcgcagaaggaaaagatacgcaaccactgggctccgctgg
acaaagtctgacattacatggagtgtccagaactacccgtctgtccataaaagactgaca
cccactcaagtcgaccctataatatcctatgccctgaaagcctggagtgacgtcaccaac
ctcaatttctatggagcgtcctccagcgagaaggacagagctgatatccggatctctttc
gcccgctcgctccatgatgatggctatccatttgatgggaagggagggactctcgctcat
gccttcttccctggggagtcggatgttgctggagacacacatttcgacgatgatgagatt
tggacatacctagatgaaagcggcactgatttgtttgcggttgcggtgcatgagtttggt
catgctctgggtctttctcactcctcctcttccccctccatcatgaagccctattatcag
ggctctgttggagatgtaggatcctacattcttccggacgatgaccgtgaggccattcag
tcactctacggaagaaagattagctcgccgacaccttcccctaataaacctacatcacac
ctacccaaaccacctgcaacatatccgaaaggtccagtaaaacctgatccgtcaatccag
aatcgctgtgagggaggttttgatgcagtggcgaacctcagaggagaagttttctttttt
aaaggtccatatttctggcgaatccagcggacgggttctctagtgtcctttcagcctgct
cacattaagaacttctggatgggtcttcctccaaccaccaataaggtagatgcagtctat
gaaagaaaggtggacaacgcaatcatcttcttcataggctcacagtactgggtatttaaa
aacacggaggtgcttcctggctatccacgtccattgtctgactggggaatgatcactcaa
gatggaaggaaggtgatgagagtggatgcagcctttatttgggctcataatggaaaaacc
tacattttcagcggtggagagttctggaggttctctgaaggcagggagactgagctgcgc
ggtccggacacaggctatcccagaaacaccaacctctggaagggggcgccaagtaacccg
gatgacgtcatcacctggggacaaggagacgcctatttcttcaaggacaattcatactgg
gtgctgaagaatggagaaatggaccagaccagtgtcactaagaaatcaaccgcagtggac
tggatgatgtgtcagcaagagacaaccaaagctccagaaagcccacggcggagagaagga
gtgaactgctactgtgacaacagcgcgggcctgcagatgagtgtttcagcctggctactg
ctcatcacagcactgcttcatattggcttcaactcgcaataa

DBGET integrated database retrieval system