KEGG   Danio rerio (zebrafish): 405783
Entry
405783            CDS       T01004                                 

Gene name
ostf1
Definition
(RefSeq) osteoclast-stimulating factor 1
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_4 SH3_1 SH3_9 SH3_2 Ank Ank_3
Other DBs
NCBI-GeneID: 405783
NCBI-ProteinID: NP_998022
ZFIN: ZDB-GENE-040625-157
Ensembl: ENSDARG00000091555
Vega: OTTDARG00000042700
UniProt: Q6TGW5 A5PN57
Position
5
AA seq 214 aa
MSKPPPKPAKPGQVKVYRALFTFDPRTPDELYFEEGDILYISDTSDSNWWKGTCRGRTGL
IPSNYVAEQAESIDNPMHEAAKRGNLSWLRECLDNKVGINGLDKAGNTSLYWACHGGHKD
VVEILLSQPNCELNQQNKLGDTPLHAAAWKGYSDIVEMLLNKNARTDVVNNEKKTALDMA
TNAQCASLLKRKLGGVILRTHSNAEEYLDDEDSD
NT seq 645 nt   +upstreamnt  +downstreamnt
atgtcaaagcctccccccaaaccagctaaaccaggtcaggtcaaggtgtaccgggcttta
ttcacctttgacccaaggacgccggatgaactgtactttgaggaaggtgatattctgtat
atctcagatacgagtgacagtaactggtggaaagggacatgccggggaaggactggtctt
attcctagcaattacgtggctgaacaggcagagtccatagataaccccatgcatgaagca
gccaaacgaggaaatctgagctggctcagagagtgcttggataataaagttggcatcaac
ggactggacaaagcagggaacacctctctctactgggcttgccatggaggacataaagat
gtggtggagattttgctgagtcagccgaactgtgagctcaatcagcagaataaattggga
gatacgcctctacatgcagctgcctggaagggttattcagatatagttgagatgttgctt
aataaaaatgcaaggacagatgtggtaaacaatgagaagaagacggctctggatatggcc
accaacgcacagtgcgcctctctgctgaagaggaagctgggaggagtcattctgcgcacc
cacagtaacgccgaggagtatctcgatgatgaagactccgactaa

DBGET integrated database retrieval system