KEGG   Drosophila simulans: Dsimw501_GD23023
Entry
Dsimw501_GD23023  CDS       T01065                                 
Symbol
Dsim_GD23023
Name
(GenBank) uncharacterized protein
  KO
K02942  large subunit ribosomal protein LP1
Organism
dsi  Drosophila simulans
Pathway
dsi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Dsimw501_GD23023 (Dsim_GD23023)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dsi03011]
    Dsimw501_GD23023 (Dsim_GD23023)
Ribosome [BR:dsi03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    Dsimw501_GD23023 (Dsim_GD23023)
SSDB
Motif
Pfam: Ribosomal_60s Cytomega_UL84 DUF3824
Other DBs
NCBI-ProteinID: KMY87310
FlyBase: FBgn0194414
UniProt: B4Q638
Position
2L
AA seq 112 aa
MSTKAELACVYASLILVDDDVAVTGEKINTILKAANVEVEPYWPGLFAKALEGINVKDLI
TNIGSGVGAAPAGGAAPAAAAAAPAAESKKEEKKKEEESDQSDDDMGFGLFD
NT seq 339 nt   +upstreamnt  +downstreamnt
atgtccaccaaagccgagctcgcctgcgtctacgcctccctcatcctcgtcgatgacgat
gtcgccgtcaccggtgagaagatcaacaccatcctgaaggccgccaatgtcgaggtggag
ccctactggcccggtctcttcgccaaggccctggagggcatcaacgtcaaggacctgatc
accaacatcggatccggagttggtgccgcccccgccggtggtgctgcccccgctgccgcc
gccgctgctccagccgccgagtccaagaaggaggagaagaagaaggaggaggagtccgac
cagtctgacgacgacatgggcttcggtctgttcgactaa

DBGET integrated database retrieval system