KEGG   Erwinia billingiae: EbC_pEb10200610
Entry
EbC_pEb10200610   CDS       T01270                                 
Name
(GenBank) Putative plasmid transfer protein
  KO
K12071  conjugal transfer pilus assembly protein TraD
Organism
ebi  Erwinia billingiae
Brite
KEGG Orthology (KO) [BR:ebi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ebi02044]
    EbC_pEb10200610
Secretion system [BR:ebi02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   EbC_pEb10200610
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 T4SS-DNA_transf AAA_22 Perilipin
Other DBs
NCBI-ProteinID: CAX53339
UniProt: D8MJF1
Position
pEB102:complement(54851..56950)
AA seq 699 aa
MSDKYVIEALLRPAVELNTAVVAGTAAIICVTAPWAVALAPSVSCVTAGGFAVLSAVRAR
QGMQVIHYRRNLRRLPRYVMTSKQIPVSKRRLFIGRGFRWTQKHTQRLRDTLRPEVAHYL
KPSKLYQLARRIEEATEKTLPAIGRLLSADRVLNPVRPLPPVGGNPAIHGIEPNETDVTL
DLRERVGHTVVYGTTRVGKTRLAELLITQDIRRGDVTIVFDPKGDADLLKRVWAEAHRAG
RGDELTVFHLGWPDISARYNAVGRFGRVSEVATRVAGQLSGEGNSAAFREFAWRFVNIVA
RALVALGERPDYTRITRYVNNIADLYLRYAEKIITEQMPELNSQIENNANAFSEDDVPRN
MQGQPEAVRIWAVEVALSSDVGQQLYDPILDGLRSAVRYDRTYFDKIVASLLPLLEKLTT
GKTAELLSPDYLNMEDPRPIFDWEQVIRKKGIVYVGLDALSDSEVASAVGNSMFADLVSV
AGQIYKHGINGGLPGSREGNDPINLHCDEFNELMGNEFIPLINKGGGAGMQVTAYTQTSS
DIEARIGSAAKTAQVQGNFNNLIMLRVKENRTAELLTSQLPQVEIYSKTLVSGHQDSADV
TVNHDFTSSTQDRVGTIKVPLLEPSDIVTLPKGQAFALLEGGQLWKIRMPLPAGDAGDVH
MPANIARLAEEMRRNYHSSEGWWDSRVSAAALVKGDNNG
NT seq 2100 nt   +upstreamnt  +downstreamnt
atgagtgataaatacgtaatcgaggcactactgcgcccggctgtagagctcaatactgcc
gttgttgccggcaccgccgccatcatatgcgttaccgcgccttgggcggtggcactcgcg
ccttccgtcagctgcgtcaccgccggaggattcgcggttctttctgctgtgcgcgcgcgt
cagggaatgcaggtgatccactaccgccgtaatctgcgacgtctgccgcgttacgttatg
acgtcaaaacagatccccgtcagtaaacgccggctctttattggcagagggtttcgctgg
actcagaagcatacccagcgcctgcgcgatacgctgcgccccgaggtagcccactatctg
aagccctcgaaactgtatcagcttgcccgcaggattgaggaggccacagagaaaacgctg
ccagcgatcggcagactgctcagtgctgacagggtgttaaatccggtccgtccgctgcct
ccggttggcggcaatccggcaatccatggcatagaaccaaatgaaactgatgttacgctc
gatttacgggagcgtgtgggccatacggttgtgtatggcactacccgcgtgggcaaaacg
cgccttgctgagcttttaattactcaggatatacggcgcggtgacgtcaccatcgtgttt
gatccgaaaggagatgctgacttgctgaaaagggtctgggcggaagctcaccgggctggt
cggggcgatgagctgaccgtttttcatctgggctggcctgacatatcagcacggtataac
gccgtaggccgtttcggccgcgtatcggaagtggctacccgcgttgccggccagctcagc
ggtgaaggtaacagcgcggcgttccgagagtttgcctggcgattcgtgaacatcgttgcc
agggcgctggttgcccttggggagcgtccggattacacccggattacacgctatgtgaac
aatattgctgatttgtacctgcgctacgctgaaaaaatcattactgagcaaatgcccgaa
ctgaacagtcagatcgaaaataacgcgaatgccttcagtgaagacgatgtgccgcgcaac
atgcagggccagcctgaagctgtgcgcatatgggcggttgaggtggcgctgagttctgat
gtcggccagcagctttacgatccgattcttgatggccttcggtcggctgtgcgttatgac
cgcacttattttgacaaaattgttgcgtcattactgccgcttctggaaaagctgacaacg
ggcaaaacggctgagttactgtcacccgattacctgaacatggaagatccgcgacccatt
tttgactgggaacaggttatccgtaaaaaaggcatcgtctacgtaggcctcgatgcgctc
agcgacagcgaggttgccagcgccgtgggtaatagtatgtttgccgatctggtgagtgtg
gcgggacagatttacaagcacggtatcaacggcggcctgcctggctcccgggaaggtaac
gatccaatcaaccttcactgcgacgagttcaatgaactgatggggaacgaatttataccc
cttatcaacaaaggcggcggtgccggcatgcaggttacggcttatacacagacgtcatca
gatattgaggcccggatcggaagtgcggcaaaaaccgctcaggtgcagggtaacttcaac
aacctgatcatgctgcgcgtgaaggaaaacaggacggccgagctgctgacctcgcagctg
ccgcaggttgaaatctacagcaaaacgctggtctcagggcatcaggattcagctgacgtc
accgtcaaccatgatttcacctccagcacacaggaccgcgtcggcacgatcaaagtgcca
ttactggagccatcggacatcgtcacgctgccaaaaggtcaggcatttgcgctgcttgaa
ggtggtcagctctggaagatacgcatgccgctgccggctggcgatgccggcgacgtgcat
atgcctgcaaacatagcgcgtctggcggaagaaatgcggcgcaactatcacagcagtgag
ggatggtgggacagtcgcgtttcggcagcagcgctggtaaagggagataataatggctga

DBGET integrated database retrieval system