KEGG   Equus caballus (horse): 100053844
Entry
100053844         CDS       T01058                                 
Symbol
TTN
Name
(RefSeq) titin isoform X1
  KO
K12567  titin [EC:2.7.11.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb05410  Hypertrophic cardiomyopathy
ecb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100053844 (TTN)
   05414 Dilated cardiomyopathy
    100053844 (TTN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100053844 (TTN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100053844 (TTN)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ecb04812]
    100053844 (TTN)
   04147 Exosome [BR:ecb04147]
    100053844 (TTN)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100053844 (TTN)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   100053844 (TTN)
Membrane trafficking [BR:ecb04131]
 Others
  Actin-binding proteins
   Others
    100053844 (TTN)
Cytoskeleton proteins [BR:ecb04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     100053844 (TTN)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100053844 (TTN)
SSDB
Motif
Pfam: I-set fn3 Ig_3 ig Ig_2 V-set Pur_ac_phosph_N fn3_2 C2-set_2 Receptor_2B4 Pkinase C1-set Tissue_fac Ig_6 PK_Tyr_Ser-Thr Titin_Z Adeno_E3_CR1 Ig_4 PPAK NDNF THB
Other DBs
NCBI-GeneID: 100053844
NCBI-ProteinID: XP_023477838
Ensembl: ENSECAG00000012544
VGNC: 51493
Position
18:complement(56785112..57053971)
AA seq 33441 aa
MATQAPTFTQPLQSVVVLEGSTATFEAHVSGLPVPEVSWFRDGQAISTSTLPGVQISFSD
GRARLTIPAVTKANSGRYSLRATNGSGQATSTAELLVTAETAPPNFVQRLQSMTVRQGSQ
VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGELYSLLIAEAYPEDSGTYSVNATN
SVGRATSTAELLVQGEEVVPAKKTKTIVSTAQISETRQTRIEKKIEAHFDARSIATVEMV
VDGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPTPSP
VRSVSPAGRISTSPIRSVKSPLLVRKTQTSTLAQGPEVPPPWKQEGYVASSEAEMRETTV
TSATQIRTEERWEGRYGVQEEVTISGAAGAAASVSVSAAFAAGAVATGAAEVKQETDKSA
AVATVVAAVDMARVREPVISAVEQTAQRTTTTATHIQPAQEQIRKEAEKTAVTKVVVAAD
KAKEQELKRTREVITTKQEQVHVTHEQIRKETEKAFVPKVVISAAKAKEQETRITGEITK
KQEQKQITQETIMKETRKTVVPKVIVATPKVKEQDLVSRTREGITTKREQVEITQEKMRK
EAEKTALSTIAVATTKAKEQETILRTREAKATRQEQIQVTQEKVDVGKKAEAVATVVAAV
DQARVREPRAPAHLEESYAQQTTLEYGYKEHISATKVAEHPQRPASEPHVVPKAVKPRVI
QVPSETHVTTTDQMGMQISSQIKKTTDLTTERLVHVDKRPRTASPHFTVSKISVPKTDHG
YEASIAGTAIATLQKELSATSPAQKITKSVKAPTVKPAETRVRAEPTPSPQFPFADIPET
YKSQAGIEVKKEVGVSIAGATVREEHFEVLHGREVKVTEAARVPAPVEIPVTPPTLVSGL
KNVTVIEGESVTLECHISGYPSPKVTWYREDYQIESSIDFQITFQSGIARLMIREAFAED
SGRFTCSAVNEAGTVSTSCYLAVQASEEFEKETTAVAEKVTTEEKRFVESRDVVMTDTSI
TEEIAGPGEPAAPFFITKPVVQKLVEGGSIVFECQVGGNPKPHVYWKKSGVPLTSGYRYK
VSYNKQTGECRLVISMTFADDAGEYTIVIRNKHGETSASASLLEEAEYESLVKSQQEMLY
QTQMTAFVQEPKVGEIAPGFLYSEYEKEYEKEQALIRKKMAKDTVMVRTFVEDQEFHISS
FEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAIESGFELRVKNYRILEGMGVT
FHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNI
KGNAICSGKLYVEPAAPLGAPTYIPTPEPVSRIRSVSPRSVSRSPIRISPARMSPARMSP
ARMSPARMSPGRRLEETDESQLERLYKPVFVLKPASFKCLEGQTARFDLKVVGRPMPETF
WFHDGQQIVNDYTHKVVIKEDGTQSLIIVPAAPSDSGEWTVVAQNRAGRSSISVMLTVEA
VEHQVKPVFVEKLKNVNVKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGT
KGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERRLIIPRGTYRA
KEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPI
GDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYNRDSGVITCRATNKYGTDHTS
ATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLFPEP
VRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGE
VKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPKPEFHVHEPGKLQFEVQKVDRPVD
TTETKEVVRLKRAERITHEKVSEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEE
LLRKTKEELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTV
GQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASI
MVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYK
DGVEIHKGNKYRMHSDRKVHFLSVLTIDPSDAEDYSCVLVEDENVKTTAKLIVEGAVVEF
VKELEDIEVPESFSGELECIISPENIEGKWYHNGVELKSNGKYTITSRRGRQNLTVKDVT
KEDQGEYSFVADGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLENVEGVWM
KDGQEVQSSDRVFIVIDKQSHMLLIEDMTKEDAGNYSFTLPALGLSTSGRVSVYSVDVIT
PLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVHAIVKGTKQRLVINRTHA
SDEGPYKLMVGRVETSCDLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKG
KEIKPNAKYKIEAHGKIYKLTVLNMMKDDEGEYTFYAGENMTSGKLTVAGGAISKPLTDQ
TVAESQEAVFECEVANPDSEGEWLRDGKHLPLSKNIRSESDGHKRRLIIAASKLDDIGEY
TYKVATSKTSAKLKVEAVKIKKTLKNLTVTETQDAVFTVTLTHPNVKGVQWIRNGVVLES
NDKYDVSVKGTTYSLRIKNCAVSDESVYGFKLGRLGASARLHVETVKIIKKPRDVTALEN
ATVAFEVSVSHDTVPVKWFHKNVEIKPSDKHRLVSERKVHKLMLQHISPSDAGEYTAVVG
QLECKAKLFVETLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKI
VVQGKLHQLLIMNTSTEDAAEYTFVCGNDQVSATLKVTPIMITSMLKDINAEEKDTITFE
VTVNYEGISYKWLKNGVEIKSTDRCQMRTKKLTHSLNIRNVHFGDAAEYTFVAGKATSTA
TLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDGQELQIVDRIKIQKEK
YVHRLLIPSTRMSDAGQYTVVAGGNMSTANLFVEGRDVRIRSIKKEVQVIEKQRAVVEFE
VNEDDVDAHWYKDGIEINFQIQERHQYVVERRIHRMFISETRHSDAGEYTFVAGRNRSSV
TLYVNAPEPPQILQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLH
DGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIIT
PLQDTVTSEGQPARFQCSVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPE
DEGTYTFAASNAMGQVSSTANLRLEAHESLLHERIEEQIEVEMKAAPVLRRRIEPLEVAL
GHLAKFTCEIQSAPNVRFQWFKAGRQIYDSDKYSIRSSKYVSSLEILRSQVVDCGEYTCK
ASNEYGSVSCTATLTVTEAYPPTFYSRPKSVTTFVGKAAKFLCTVLGTPVIETVWQKDGA
ALSPSPNCKISDAENKHILELSNLTIQDQGVYSCKASNKFGADICQAELIIIDKPHFIKE
LEPVQSAINKKIHLECQVDEDRKVTVTWKKDGQKLPPGKDFKIYFEDKIASLEIPLAKVK
DSGTYVCTASNEAGSSSSSATVTIREPPSFVKKVEPSYLMLPGESARLHCKLKGSPVIQV
TWFKNNKELNESNTIRMSFVNSEAVLDITDVKVEDSGSYSCEAVNDVGSDSCSAEIVVKE
PPSFIKTLEPADIVRGSNALLQCEVAGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVSLE
IFAFNSADVGEYECVVANEVGKCGCLATHLLKEPPTFVKKVDDFTALAGQTVTLQAAVRG
SEPISVTWMKGQEVIKEDGKIKMSFSNGVAVLIIPDVQISFGDRYTCLAENEAGSQTSVG
ELIVKEPAKIIERAELIQVTAGDPATLEYTVTGTPELKPKWYKDGRPLIASKKYRISFKN
NVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVDSIVSGT
CRLDCKIAGSLPMRVSWFKDGKEIASSDRYRIAFVEGTASLEISRVDMNDAGNFTCRATN
SVGSKDSSGALIVQEPPSFVTKPASKDVLPNSAVCLKSTFQGSAPFTVRWFKGDKELVSG
GSCYITKEALESSLELYAVKTSDSGTYTCKISNVAGSVECSANLFVKEPATFVEKLELSQ
LLKKGDTAELACKVTGTPPIKITWFVNDREIKESSKHRMSFVESSAVLRLTDVATEDSGE
YMCEAQNEAGSDHCTGVLIVKEAPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITWFKD
NTTLRSGRKYKTLIQDQLVSLQILKFVAADAGEYQCRVTNEVGSSTCSARVTLREPPTFV
KRIESTSSLRGGTAAFQATLKGSLPITVTWLKDNDEITEDENIRMTFENNVASLYLSGIE
VKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEEAVSIDVTQGDPATLQVKFSGTKEIT
AKWFKGGQELTLGQKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCRASINVL
DLIIPPSFTKKLKKMDSIKGSSIDLECIVAGSHPISIQWFKDDQEISASEKYKYSFHDNT
AFLEISHLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQDVNPNTRVQLKA
LVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTVLELFSAKAADSGTYICQLSNDVGTV
TSKVTLFVKEPPQFIKKPSPVLVLRNGQSTTFECQITGTPEIRVSWYLDGNEITAIRKHG
ISFVDGLATFQISGARVENSGTYVCEARNDAGTASCSIQLKVKEPPTFIRELQPVEVVKD
SDVELECEVMGTSPFEVTWLKNNREIRSSKKYTLSDRVSVFYLHITKCDPSDTGEYQCII
SNEGGSCSCSARVSLKEPPSFIKKIENVTTVLKSSATFQSTVAGSPLISVTWLKDDQILD
EDDNVHISFVNNVATLQIRTVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQIIEKAKS
VDVTEKDPVTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMMQDSG
QYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSSVHMECKVSGSLPISAQ
WFKDGKEISTSAKYRLVCHENTVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEP
PSFLVKPERQQAIPDSTVEFKAVLKGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSFLNL
YSVDASKTGQYTCQVTNDVGSDSCTTLLFVTEPPKFVKKLEASKIVKAGDSARLECKITG
SPEIRVVWYRNEHELPASDKYRMTFIDSVAVIQMNNLGTEDSGDFICEAQNPAGSTSCST
KVIVKEPPVFSSFPPVVETLKNTEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKIVSKN
FHASIHILNVETSDIGEYHCKAQNEVGSDTCICTVQLKEPPRFVSKLNSLTVVAGEPAEL
QASIEGTQPIYVQWLKEKEEVIRESENIRITLVENIATLQIARAEPANAGKYICQIKNDG
GTRENMATLTVLEPAVIVEKAGSMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQK
HKFSFYNKISSLKILSVEKQDAGTYTFQVQNNVGKSSCTAVVDVSDRTVPPSFTRRLKDT
GGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGN
YTCVAANVAGSDECRAVLAVQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTSPFKVGWFRG
ARELVKGDRCNIYFEDTVAELELFNVDISQSGEYTCVVSNNAGQTFCTTRLYVKEPAAFV
KKLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITPSEKCNIVTTEKTCLLEILNST
KRDAGQYSCEIENEAGKDVCEALVSTLEPPYFVTELEPLEASVGDSVSLQCQVAGTPEIT
VSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNIHDSGEYTCKAENSIGTASSKTIFRIQ
ERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVSWYRDGVLLRDDENLQTSFVDNV
ATLKILQTDLSHSGQYSCSASNPLGTASSTARLTAREPKKSPFFDIKPVSIDVIAGESAD
FECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDV
GKDMCSAQLSVKEPPKFVKKLEASKVAKQGESTQLECKISGSPEIKVLWFRNDSELHESW
KYNMSFVNSVALLTINEASTEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSPVGA
LKGSDVVFQCEIAGTPPFEVVWVKDRKQVRSSKKFKITSKNFDTSLHILNLEASDVGEYH
CKASNEVGSDTCVCTVKFQEPPRFVKKLSDTSTLVGDAVELRAVVEGFQPISVVWLKDKG
EVIRESENTRISFIDNVATLQLGSPEASNSGKYVCQIKNDAGMRECSAVLTVLEPARIIE
KPEPMTVTTGNPFALECVVTGTPELSTKWFKDGRELSGDSKHHITFVNKVASLKIPCAEM
SDKGLYSFEVKNSVGKSNCTVSVHVSDRVVPPSFIRKLKDLNAILGSSAVLECRVAGSAP
ISVGWFQDGNEIISGPKCQSSFSENVCTLNLSSLEPSDTGVYTCVAANVAGSDECSAVLT
VQEPPSFEQTPDSVEVLPGVSLTFTSVFRGTPPFKVKWFKGSRELVSGDSCTISLEDYVS
ELELFEVEPLQSGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADFSVETGSPIVLEAT
FTGTPPISVSWMKNEFPLSQSQNCTITMTEKSTILEILDSTIEDYAQYSCLIENEAGQDI
CDALVSVLEPPYFIEPLEHVEATIGEPTTLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQ
FKNNVASLVINKVDHSDVGEYSCKAENSVGAVASSAVLVIKDRKLPPSFARKLKDVHETL
GFPVAFECRINGSEPLQVSWYKDGVLLKDDSNLQTSFVHNVATLQILQTNQSHVGQYNCS
ASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGSFKCHVTGTAPIKITWAKDN
REIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNVAGKDSCSAHLGVQEPPRFIK
KLEPSRIVKQDEYTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFLDSVAVLEMHSLS
VEDSGDYTCEARNAAGSASSSTSLKVKEPPIFRKKPHPVETLKGADVHLECELQGTPPFQ
VSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCAGSITLR
APPRFVKTLSDISTIVGEEVQLQTAIEGAEPISVVWFKDKGEVVRESDNIWISYSENIAT
LQFSRAEPANAGKYTCQVKNDAGMQECFATLSVLEPAAIVEKPESIQVTTGDTCTLECTV
TGTPELSTKWFKDGKELTSDSKYKISFFNKVSGLKIINVAPGDSGVYSFEVQNPVGKDSC
TASVRVSDRIVAPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQ
TTLTDNTCALTVNSLEESDAGDYTCVATNRAGSDECSAPLTVREPPSFVQKPDAMDVLTG
TNVTFTSIIKGTPPFMVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTMQSGEYTCIV
SNEAGKASCTTHLHVKAPAKFVKRLNDYSIEKGKHLILEGTYTGTPPISVTWKKNGINIA
PSQRCHITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQLEP
VKVTVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTATYKMHFKNNVATLVFNQVDVNDSG
EYICRAENSVGEVSSSTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFECAINGSEPISVS
WYKDGKPLKDGPNVQTSFLDNVATLNIFKTDRSLAGQYSCTATNPIGSASSSARLILTEG
KNPPFFDIPVAPVDAVVGESADFECHVTGTQPIKVGWAKDNREIRSGGNYQISFLENSAH
LTILKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKKLSETVEETEGNSFRL
EGRVAGSQPITVAWYKNNVEIHPTSNCEITFKNNTLLLQVKKAGMGDAGLYTCKVWNDAG
SALCTSSIVIKEPQKPPVFDQHLTPVTVSEGEFVQLSCHVRGSEPIRIQWLKAGREIKPS
DRCSFSFASGTAVLELKDVTKADSGDYVCKASNAAGSDTSKSKVTVKDKPAAVPAAKKAA
VDGKLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRIFIHQKGDE
AKLEIRDTTKTDSGLYRCVAFNKHGEIESNVNLQVDERKKQEKIEGDLRAMLKKTPVLKK
GAGEEEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQQEETHRLEIEEI
EKSEKEEKEFEELVSFIQQRLSQTEPVTLIKDIENQTVLKDNDAVFEIDIKINYPEIKLS
WYKGTEKLEPSDKFEISIDGDRHTLRVRNCQLKDQGNYRLVCGPHIASAKLTVIEPAWER
HLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRILKPQGRYKTEVEHKVHKLTIADVRAE
DQGQYTCKYEDLETSAELRIEAEPIQFTKRIQNIVVSEHQSATFECEVSFDDAIVTWYKG
PTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRGEARSTAELYLTTKEIK
LEMKPPDIPDSRVPIPTMPIRAVPPDEIPPTAIPPIPLLLPAPEEKKPPAKRVEVTKKAK
KVAKPKEEAPPPKVPEVAKKPPPPTALIPAKAPEIIDVSSKAEEVKIMTITRQKEVQKEK
EAVYEKKRAVYEEKKLFIESLEEPYDELEVEPYTEPYEEPYYEEPDEDYEETKVEARKEV
HEEWEEDFEAGQEYYEREEGYDEGEEEWEETYQEREAVQVQKEVYEEPHERKIPAKVPEK
KEAPPPKVVKKPVVEKIEKTSRRVEEAKVQVTKVPEVSKKIVPQKPSRTPVQEEVIEVKV
PAVHTEKMVISEEKFFASHTEEEVSVTVPKVQKKTVTEEKIQVAVSKKIEPPPKVPEPPR
KPAPEEVVPVPIPKKVEPPPAKVPEVPKKPVPEEKKPVPVPKKEPAAPPKVPEVPKKPVP
EEKVPVPVAKKKEAPPAKVAEVQKRVVTEEKVTIVTQREESPPPAVPEIPKKKVPEEKRP
VPRKEEEAPPPKVPAPPKKPVPEEKVPVPVPVPKKAPPPRAEVSKKAVVEEKRYFAEEKL
SVAVPQRTEVVRHEEEEWSYSEEQERVSISVYREEEREEEEAEVTEYEVMEEPEEYVVEE
ELHVIAERVEAEPAEVPEKKIVPKPKIPAKIEEPSPAKVPEPPKKIVPEKKLPAAVPKKE
KVPPAKVPEEPKKPVPEKRAPPKVAKIEEPVPTKVTERHMQITQEEKVLVAVTKKEEPPR
ARVPEEPKRAIPEEKVPKLKPKKEEEPPTKVAEIRKRAVKEEKVSIEVPKREPQFAKEVA
VAEEKEWSYTREEEVVSVQREEEYEEYEEEYDYKEFEEYEPTEEYEQYDEYEEREFEHYE
EYKEREEYVTEPEKPVPVKPVQEEPVPTKPKAPPVKVPKKAVPEEKVPVPIPKKLKPVPP
KVTEEAKKVVEEKIHISITKREKEQVTEPTAKVPLKLKRVVTEEKVPVPKKEVAAPVRVP
EVPKRREPEEIAFEEEVVTQVEEYHEEEEEYIYEEEELVTEEEVVPVIPVKVPEVPKKPV
PEEKKPVPVPKKKEAPPAKVPEIPKKPEEKVPVPIPKKEKAPPAKVPEVPKKPVPEEKVP
VPVPKKVEAPPAKVPEVPKKPVPEKKVPVPVPKKVEAPPAKVPEVPKKIIPEEKKPTPVP
KKVEAPPPKVPEVPKKVEERPIVVPEEEEVPPVEVFEEPEEPIPEEEIPEEPPTIEEEVE
EVAPPRVPEVVKKAVPEAPTPVPKKVEAPPAKVPKKVPEEKVPVPVQKKEAPPAKVPEVQ
KKVPEKKVPEKKIPEKKVPEKKVLVPKKEAVPPAKDALSGRTVEEKISVAFHKEEVVRER
TEFEIVEAEAVLEEEEFHEVEEYFEEEEFHEVEEFTKVEEHRFEEVHEVEEVRRVIEVLE
AEEVEVYEEPKAPPKVPEAPKEVVPEKKVPAPPPKKPEVPPVKVPEAPKEVVPEKKVPAA
PPKKPEVPPAKVPEVPKAAVPEKKVPEAIPPKPESPPPEVPEVPPKEVIPEKKVPVAPPK
KPEPPPAKVPEAPKEVVPEKKVPVPRPKKPEVPPVTVPEAPKEVVPEKKVSVAPPKKPEV
PPVTVPEAPKEVVPEKKVPVPLPKEPEVPPVKVPEPPKKVVPEKKVPVAPPKEPEVPPVT
VPEAPKEEIIPEKKVPVPPPKKSEVPPVKVPEAPKEVVPEKKVHVPPPKKPEVPPVKVPE
APKEVVPEKKVPAPPPKKPEVPPVKVPEAPKEVVPEKKVPAAPPKKPEVPPAKVPEVPKA
AVPEKKVPEAIPPKPESPPPEVYEEPEEVVPEEPPAEVVEEPEPAPPPKVTVPPKKPVPE
KKPPAVIAKKPEPPPVKVPEVPKEVVPEKKVPPVVPKKPEVPPAKVPEVPKEVVPEKKVA
VPKKPEVPPPKVPEVPKEPVVEEKPAVPIPEEVEPPPPEVYEEPEEIAPEEEEPVPVAEE
EPEAPPPAVPEEPEKIVPEKKVPVIKKPEAPPPKEPEPEKKVVEKPKLKPRPPAPAPAPP
KEDVKEKIAQLKAVSKKKVPEKPEVPEKVELKPLKVLGGEKKVRKLLPEPKPQPKEEVVL
KSVLRKKPEEEEPKVEPKKVEKVKKPAVPEPPPKPVEEVEAPPAAVTKREKKVPEPTKVP
EIKPPIPLPAPEPKPKPEPEVKIIKPPPVEPAPTPIAAPVTVPVVGKKAEAKAPKEEAAK
PKGPIKGVAKKTPSPIELEKKKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIVLTE
AESVGSSAIFECLVSPSTAITSWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEY
TCVLRLGNKEKTSTAKLIVEELPVRFVKTLEEEVTVVKGQPLYLSCELNKERDVVWRKDG
KIVVEKPGKIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWL
VKPIRDQHVKPKGTAVFTCHIAKDTPNIKWFKGYDEIPWEPNDKTEIVKDGNHLSLKIKN
ATPEDIDEYAVEIEGKRYPAKLTLGDREVELLKPIEDVTIYEKESASFDAEISEADIPGQ
WKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDF
AVPLKDVTVPEKRQARFECVLTREANVIWSKGPDIIKSSDKFDIITDGKKHILVINNSQF
DDEGVYTASVEGKTTSARLFVTGIRLKFISPLEDQTVKEGETATFVCELSHEKMHVVWFK
NDVKLHTSRTVLISSEGKTHKLEMREVTLDDISQIKAQVKDLSSTANLKVLEADPYFTVK
LHDKTGVEKDEIILKCEVSKDVPVKWFKDGEEIEPSPKYSIKSDGLRRILKIKKAELKDK
GEYVCDCGTDKTTANVNVEARLIKVEKPLRGVELFVGETARFEIELSEPDVHGQWKLKGE
PLTASPDCEIIEDGKKHILVLYNCQLDMTGEVSFQAANAKSAAKLKVKELPLIFITPLSD
VKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDKIELIKDGTKHSMVIKSAAFEDEAK
YIFEAEDKHTSGKLIIEGIRLKFLTPLKDVTAKERESAVFTVELSHDNIRVKWFKNDQRL
HTTKLVSMEDEGKIHSITFKNLSIDDTSQIKVEAMGMSSEAKLTVLEGDPYFTGKLQDYT
GVEKDEVVLQCEISKADAPVKWFKDGEEIKPSKNAIIKADGKKRMLILKKALKSDIGQYT
CDCGTDKTSGKLDIEDREIKLVRPLYSVEVMETETARFETEISEDDIHANWKLKGEALLQ
TPDCEIKEEGKTHFLILHNCRLDQAGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVT
AGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGRVHTLTLRDVKLEDAGEVQLT
AKDFKTQAKLFVKEPPVEFTKPLEDQTVEEEATAVLECEVSRENAKVKWFKNGTEILKSK
KYEIVADGRVRKLIIHGCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLRVKEK
EMARFECELSRENAKVHWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVR
TARTSGMLTVVEEEAVFTKNLTNVDVSETDTIKLVCEVSKPGAEVTWYKGDEEIIETGRY
EILTDGRKRILIIQNAHLEDTGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEK
AEFVCSISKESFEVQWKRDDKTLESGDKYDVIADGKKRILVVKDATLQDMGTYVVMVGAA
RAAAHLTVIEKLRIIVPLKDTRVKEQQEVIFNCEVNTEGAKAKWFRNDEAIFDSSKYIIL
QKDLVYTLRIRDARLDDQANYSVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEK
KSVTFWCKVNRLNVTLKWTKNGEEVAFDNRVLYRIDKYKHSLIIKDCGFPDEGEYIVTAG
QDKSVAELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKY
KFEKDGSVHRLIIKDCRLDDECEYACGVDDRKSRARLFVEEIPVEIIRPPQDILEAPGTD
VVFWAELNKDKVEVQWLKNNMIIVQGDKHQMMSEGKIHRLQICDIRPRDQGEYRFIAKDK
EARAKLELAAAPKIKTADQDLVVDVGQPLTMVVPYDAYPKAEAEWFKENEALSSKTVDTT
AEKTSFRILEAKKGDKGRYKIVLQNKHGKAEAFINLQVIDVPGPVRNLEVTETLDGEVSL
AWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDRADSCEFTVTGLQKGGVEYLFRVSARN
RVGTGEPVETANPVEARSRYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYIIE
LRDKTSIRWDTAMTVKAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADP
IERPSPPVNLSSSDQTQSSVQLTWEPPLKDGGSPILGYIIERCEEGKDEWIRCNKKLVPE
LTYKVTGLQKGNKYLYRVSAENEAGVSDPSEILGPLTADDAFAEPTMDLSSFKDGLEVIV
PNPIKILVPSTGYPRPTATWAFGDKVLEAGDRVKMKTLSAYAELVISPSERPDKGIYTLK
LENRVKAISGEIDVNVIARPSAPKELKFDDITRDSVHLTWEPPDDDGGSPLTGYLVEKRE
VNRKTWTKVIDSVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSAPATVP
DPPENVKWRDRTAKSIFLTWDPPKYDGGSRIKGYIVEKCPRGSDRWVACGEPVAETKMEV
TGLDEGQWYSYRVKALNRQGASKPSKPTDEIQAVDAQEAPEIFLDVKLLAGLTVKAGTKI
ELPATVTGKPEPTITWTKADTLLRQDKRITIENVPKKSTVTIVDSKRSDTGRYIIEAVNV
CGRATAVAEVNVLDKPGPPAAFDITEVTNESCLLTWNPPRDDGGSKITNYVVERRAADSD
MWHKLSSTVKDTKFKATNLIPNKEYLFRVAAENMYGVGEPVQATPITAKYQFDPPGPPTR
LEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLT
NKKKYRFRVLAENLAGPGKPSRSTEPILIKDPIDPPWPPGKPTVKDIGKTSIMLNWTKPE
HDGGAKIESYVIEMLKTGTEDWVRVAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEP
SEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRK
GWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYCEVEDSVLAKDTFTTPGPPY
ALTVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKEKLGTRWVKAGKTSGPDCNFRVTDV
IEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPP
EKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAVGV
SEPSEISENVVAKDPDCKPTIDLETHDIVVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVK
ASDRLTMKSDHISAHLEVPKSVHADAGVYTITLENKLGSATGSINVKVIGLPGPCKDIKA
SDVTKSSCKLTWEPPEYDGGSPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGE
YFFRVKAVNKIGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGG
SKIMGYIIEKIAKGEERWKRCNEHLVPVLTYTAKGLEEGKEYQFRVRAENAAGISEPSRA
TPPTKAVDPIDAPKVILRSSLEVRRGDEIALDATISGSPYPTITWIKDEEIITPEEIKKR
VAPMVRRRRGEVQEEEPFVLSLTERLSIDNSKKGESQLRVRDSIRPDHGQYMIKAENDHG
IAKAPCTVSVLDTPGPPINFVFEDVRKNSVVCKWEPPLDDGGSEIINYTLEKKDKTKPDS
EWIVVTSTLRHCKYPVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLIAKDPFEPPDAPDK
PIVEDVTSNSMLVTWNEPKDNGSPILGYWLEKREVNSTHWSRVNRNLLNSLKTNVEGLLE
GLTYVFRVCAENAAGPGKFSPPSDPKTARDPIAPPGPPVPRVADTSSTTIELEWEPPAFN
GGGEIIGYFVDKQLVGTNEWSRCTEKMIKARQYTVREIREGADYKLRVSAVNAAGEGPPG
ETEPVTVAEPKEPPTVELDVSVKAGIQIMAGKTLRIPAVVTGRPVPTKVWTIEEGELDKD
RVVIENVGTKSELIIKNALRKDHGRYVITATNSCGSKFAATRVEVFDVPGPVLDLKPVVT
NRKMCLLNWSDPEDDGGSDITGFIIERKDAKMHTWRQPIETDRSKCDITGLLEGQEYMFR
VIAKNKFGCGPPVEIGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRNNGGSPIQG
YIIEKRRHDKPDFERVNTRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVI
QDDEVPPTIKLRLAVRGDTIKVKAGEPVNIPADVTGLPMPKIEWSKNETVIEKPTDALKI
TKEEVSRSEAKTELSIPKAVRADKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTD
IKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKSEWEEVTNTAVEKRYGIWKLIPNGQ
YEFRVRAVNKYGISDDCKSDKVVIQDPYRPPGPPGKPKVLERTKGSMLVSWTPPLDNGGS
PITGYWLEKREEGGAYWSRVSRAPITKTGLKGVEFNVPRLIEGVKYQFRAMAINAAGVGP
PSEPSDPAVAGDPIYPPGPPSCPEVKDKTKSSISLAWKPPAKDGGSPIKGYIVEMQEEGT
TDWKKVNEPDKLLTTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDILEVP
EVFIDIGAQDCLICKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKALKDGVHDIPEDAQLE
TAENSSVIIIPECKRSHSGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSC
RLSWKMPDDDGGDRIKGYVIEKKTIDGKAWTKVNPNCGSTTFVIPDLISEQQYFFRVRAE
NRFGIGAPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIV
ECLAWDPTGKKKEAWKQCNKRDVEELEFTVEDLVEGGEYEFRVKAVNAAGVSKPSETVGP
VIVKDQTCPPSIELKEFMEVEEGTDVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVVYDT
HVNKVVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFES
ISADQMTISWLPPKDDGGSKITNYVIEKREPNRKTWVHVTSEPTECMYTIPKLLEGHEYV
FRIMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPV
TGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASL
PSDPVTARDPIAPPGPPFPKVTDWTKSTADLEWSPPLKDGGSRVTGYIVEYKEEGKEEWE
KAKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDAIEMKDRLVLPDVQLDA
SVRDRIVVHAGGVIRIIAYVSGKPPPTITWNMNERALPQEANIETTAISSSMVIKNCQRS
HQGVYSLLAKNAAGERKKTIIVDVLDVPGPVGIPFLPHNLTNDSCKLTWFSPEDDGGSPI
TNYVIEKREADRKAWTPVTCTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETTEEL
VIRDPITVPERPEDLEVKEVTKDSVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTS
DNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLDLDFRDKL
TIRVGEAFALTGRYSGKPKPKVTWFKDEADVLEDDRTQIKTTPTTLALEKIKAKRSDSGK
YCVVVENSTGSRKGFCQVNVVDRPGPPVGPVIFDEVTKDHMIISWKPPLDDGGSEITNYI
IEKKEVGKDVWMPVTSACAKTTCKVPKLLEGKDYIFRIHAENLYGISDPLVSDSMKAKDR
FRVPDAPDQPIVTEVTKDSALVTWNKPNDGGKPITNYILEKRETMTKRWVRVTKEPIHPY
TKFRVPDLLEGCYYEFRVSAENEIGIGDPSPPSKPVCAKDPIAKPSPPVNPEAIDTTCNS
VDLTWQPPRHDGGSKILGYIVEYQKVGDEEWKRANHTPESCPETKYKVTGLRDGQSYKFR
IRAVNEAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIRVGDTLRLSAVIKGVPFP
KVTWKKEDREAPTKARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLD
KPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVVTNYVVERRDVASAQWSPLSTTSKKKSH
LAKHLNEGSQYLFRVAAENQYGRGPFVETPKPIKAVDPLHPPGPPKNLHHVDVDKNEVSL
VWNKPDRDGGSPITGYLVEYQEEGTEDWIKFKTVTNLECVVTGLQQGKTYKFRVKAENIV
GLSLPDTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDG
SEIKTDDHYTVETDSYSSVLTIKNCLRKDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPT
GPINILEVTPEHMTISWQPPKDDGGSPVINYIVEKKDTRKDTWGVVSSGSSKTKLKVPHL
QKGFEYVFRVRAENKMGVGPPLDSVPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPK
SDGGSPITGYYVERREITGKWVRVNKTPITELKYTVTGLYDGNTYEFRVFAENLAGLSSP
SPSSDPIKACRPIKPPGPPINPKLKDKTRETADLVWTKPLSDGGSPILGYVVECQKPGTA
QWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEV
ELDVTCRDVITVRVGQTIRILARVKGRPEPDITWSKEGKALVREKRVDIIHDLPRAELQI
KEAIRADHGKYIISAKNSSGHAQGSTIVNVLDRPGPCQNLRVSNVTKENCTIAWENPLDN
GGSEITNFIVEYRKPNEKGWSIVASDVTKRLIKANLLANNEYYFRVCAENKVGVGPTIET
KTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSADWE
RVHKGSIKETHYMVDKCVENQIYEFRVQTKNEGGESDWVKTEEVVVKEDLQKPVLELKLS
GVLTVKAGDTIRLEAGVRGKPFPEVLWTKDKDATDLTRSPRVKIDTSADSSRFSLTKAKR
SDGGKYVITATNTAGSFVAYATVNVLDKPGPVRNLKITDVSSDRCTICWDPPEDDGGCEI
QNYILEKCESKRMVWSTYSATVLTTGATVTRLIEGNEYIFRVRAENKIGTGPPTESKPVI
AKTKYDRPGRPDPPEVTKVSKEEMTVVWTPPEYDGGKSITGYFLEKKEKHGTRWVPVNKS
AIPERRLKVQNLLPGHEYQFRVKAENEIGIGEPSLPSKPVVAKDPIEPPGPPTNLKVVDT
TKSSITLAWGKPVYDGGAPIIGYVVEMRPKRPDMSPDEGWKRCNAAAQLVRMEFTVTSLD
ENQEYEFRVCAQNQVGIGRPAELKDAIKPKEILEPPEIDLDASMRKLVTVRAGCPIRLFA
IIRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKA
VFVNVRVLDTPGPVSDLKVSDVTKTSCHISWGPPENDGGSQVTHYIVEKREADRKTWSTV
TPEVKKTSFQVTNLVPGNEYFFRVTAVNEYGPGVPTDVPKPVLASDPLCEPDPPRKLEVT
EMTKNSAALAWLPPLRDGGAKIDGYIISYREEEQPADRWTEYSVVKDLSLVVTGLKEGKK
YKFRVVARNAVGVSLPRETEGVYEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHP
TCKWKKGEDEVVTSSHLAVHKADNSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVIV
MDAPGPPQPPFDISDIDADACTLSWHIPLEDGGSSITNYIVEKCDVSRGDWVTALASVTK
TSCRVGKLIPGQEYIFRVRAENRFGISEPLTSPKMLAKFPFGVPSEPKNARVTKVNKDCI
FVAWDRPDSDGGSPITGYLIERKERNSLLWVKANDTPVRSTEYPCAGLVEGLEYSFRIYA
LNKAGSSPPSKPTEYVTARMPVDPPGKPEVIDVTKNTVSLIWARPKHDGGSKIIGYFVEA
CKLPGDKWVRCNTTPHQIPQEEYTVTGLEENAQYQFRAIAKTAVNISQPSEPSDPVTIVA
ENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKEGTLLQPAEGIKMAMKR
NLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLS
WEPPLEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKY
GVGDPIFTEPAVAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLVEKRE
TQAVNWTKVNRKPVIERTIKATGLQEGTEYEFRVTAINKAGPGKPSDASKAVYAQDPLYP
PGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQKLQKTR
FEVTGLLENTEYQFRVYAVNKVGYSDPSDVPDKHCPKDILIPPEGELDADLRKTLILRAG
VTMRLYVPVKGRPPPKITWSKPNVNLRERIGLDIKSTDFDTFLRCENVNKYDAGKYILTL
ENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYITWDPPIIDGGSPIINYVVEKRDA
ERKSWSTVTTECSKTSFRVSNLEEGKSYFFRVFAENEYGIGDPGETRDAVKASETPGPVV
DLKVTSVTKSSCSIGWKKPRSDGGSRIIGYVVDFLTEENKWQRVMKSASLQYSTKDLTEG
KEYTFRVSAENENGEGTPSEITAVAKDDVVAPDLDLKDLPDLCYLAKENSNFRLKIPIKG
KPAPSVSWKKGEDPLATDTRVSVESSAVNTTLVVYDCQKSDAGKYTITLKNVAGTKEGTL
SIKVVGKPGIPTGPIKFEEVTAEAITLKWGPPKDDGGSEITNYILEKRDSVNNKWVTCAS
AVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVAKHPFDVPDAPPPPNIVDVR
HDSVSLTWTDPRKTGGSPITGYHIEFKERNSLLWKRANKTPIRMKDFKVTGLTEGLEYEF
RVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINVTRNSVTLIWTEPKYDGGHKLTGY
IVEKRDLPSKSWTKANHVNVPDCAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTGTII
CKDEYEAPTIVLDPTIKDGLTIKAGDTIILSAISILGKPLPKSSWSRAGKDIRPSDIVQI
SSTPTSSMLTVKYATRKDAGEYTITATNPFGTKEEHVKVIVLDVPGPPGPIEISNVSAEK
ATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVAEDIQSCRHVATKLIQGNEYIFRVSA
VNQYGKGEPVQSEPVKMVDRFGPPGPPGKPEISNVTKNTATVSWKRPTDDGGSEITGYHV
ERREKKSLRWVRATKTPVSDLRCKVTGLQEGNTYEFRVSAENKAGVGPPSDASNPVLMKD
VAYPPGPPSNARVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTAL
RITEFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAPDFELDAELRRTLVV
RAGLSIRIFVPIKGRPAPEVTWTKDDINLKNRANIENTESFTLLIIPECNRYDTGKFVMT
IENPAGKKSGFVNVRVLDTPGPVLNLKPTDITKDSVTLHWDLPLIDGGSRITNYIVEKRE
ATRKSYSTVTTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKASEAPSPP
DSLNIMDITKSTVSLAWPKPKHDGGSRITGYVIEAQRKGSDQWTHITTVKGLECVVRNLT
EGEEYTFQVMAVNSAGRSAPRESRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIP
VLGRPKPTVTWKKGDQILKQTQRVNFENTATSTILNINECVRSDSGPYPLTAKNIVGEVG
DVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVE
LATTVIRTTYKATRLTTGMEYQFRVKAQNRYGVGPGITSASIVANYPFKVPGPPGTPQVT
AVTKDSITISWHEPLSDGGSPILGYHIERKERNGILWETVSKALVPGNIFKSSGLTDGIA
YEFRVIAENMAGKSKPSKPSEPAFALDPIDPPGKPVPLNITRHTVTLKWAKPEYTGGFKI
TSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSD
AITCRDDIEAPRIMVDVKFKDTVILKAGEAFKLEADVSGRPPPTMTWTKDGKELEGTAKL
EIKIADFSTNLVNKDSSRRDGGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVSEVT
SEKCVLSWLPPLDDGGAKIEHYVVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFR
VMAVNKYGVGEPLESEPVLAVDPFGRPDPPKNPEVTAITKDSMVVCWGHPDSDGGSEIIN
YIVERRDKAGQRWVKCNKRTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYK
ACDTVYKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWKIVTPP
AGLKATSYTITNLTENQEYKIRIYAMNSEGIGEPALVPGTPKAEERMLPPEIELDADLRK
VVTIRACCTLRLFVPIKGRPAPEVKWTREHGESLDKASIESTSSYTLLIVGNVNRFDSGK
YILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWEPPLLDGGSKIKNYIV
EKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASER
PLPPGKITLVDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDKWVTCATVKVTEATI
TGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVD
VPFIGRPTPAVTWHKDDVPLKQTTRVNAESTENNSLLTIKEACREDVGHYTVKLTNSAGE
ATETLNIIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTVW
QIVSATVARTTIKASRLKTGCEYQFRIAAENRYGKSTYLTSEPIVAQYPFKVPGPPGTPF
VTLSSKDSMEVQWNEPVSDGGSKVIGYHLERKERNSILWVKLNKTPIPHTRFKTTGLDEG
IEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIMVTRNSVTLQWKKPTYDGGS
KITGYVVEKKELPDGRWMKASFTNVIDTQFEVTGLVEDHRYEFRVIARNAAGVFSEPSES
TGAITARDEVDPPRISMDPKYKDTIVVHAGELFRIDADIYGKPIPTIQWIKGDQELSNTA
RLEIKSTDFATSLSVKDAVRIDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISG
VTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEGNEYT
FRIMAVNKYGVGEPLESEPVMAKNPFVVPDAPKAPEITTVTKDSMIVVWERPASDGGSEI
LGYVLEKRDKEGVRWTRCHKRLIGELRLRVTGLLENHNYEFRVSAENAAGLSEPSPPSAY
QKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCT
PPTGINKTNIEVEKLLEKHEYNFRICAVNKAGVGEHADVPGPVIVEEKLEAPDIDLDLEL
RKIINIRAGGSLRLFVPIKGRPTPEVKWGKMDGEIRDAAIIDVTSSFTSLVLDNVNRYDS
GKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNY
IVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEFGIGLPAHTADPVKVA
EVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKSLEA
VITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVRPAFHSYSVQVGQDLK
IEVPISGRPKPTVTWTKDDLPLKQTTRINVTDSLDLTVLSIKETHKDDGGHYGITVANVV
GQKTASIEIITLDKPDPPKGPVKFDEVSSESITLSWNPPLYTGGCQITNYIVQKRDTTTT
VWDTVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGT
PFVTTTSKDSMVVQWHEPINNGGSPVIGYHLEKKERNSILWTKVNKSIIHDTQFKAVNLE
EGIEYEFRVYAENIVGVGKVSKNSECYVARDPCDPPGTPEAIMVKRNEITLQWTKPAYDG
GSMITGYIVEKRDLPEGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGTISKPS
DSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEE
SARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQV
TGVTSEKCNLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKITKLLEGNE
YIFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNTAKDSMTVCWNRPDSDGGS
EIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPAT
VYYKACDPVFKPGPPINAHVVDTTKNSITLTWGKPIYDGGSEILGYVVEICKADEEEWQI
VTPQTGLKATRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDS
ELRKGIVVRAGGSARIHIPFKGRPTPDITWSREEGEFTDKVQIEKGVNYTQLSIDNCDRN
DAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVKKDSVILVWEPPMIDGGAKVK
NYVIDKRESTRKAYANVSNKCSKTSLKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVK
AAEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRILGYVVEMQPKGTEKWSVVAESKVC
NAVITGLSSGQEYHFRVKAYNEKGRSDPRVLGVPVIAKDLTIPPSFKLPFNTYSVQAGED
LKIEIPVIGRPRPEISWVKDGEPLKQTTRVNVEETANSTILHIKETNKDDFGKYTITATN
IAGTATENLSIIVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTT
TTTWQTVSATVARTTIKIAKLKTGTEYQFRIFAENRYGKSTHLDSKPVIVQYPFKEPGPP
GTPFVTSVSKDQMLVQWHEPVNDGGSKVIGYHLEQKEKNSILWIKLNKTPIPDTKFKTTG
LDEGIEYEFRVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNNVTLKWKKPAY
DGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSE
PSESTGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDIVWLKDGKEL
EETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGP
LKVSGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNYKVTKLLP
GNEYIFRVMAVNKYGVGEPLESEPVIARNPYKPPGPPSPPEVSAITKDSMVVTWARPVDD
GGAEIEGYILEKRDKEGVRWTKCNKKTLTDLRFRVTGLTEGHSYEFRVAAENAAGVGEPS
EPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWNKPIYDGGAPVKGYVVEVKEATADE
WTTSTPPTGLQGKQFTVTNLKENTEYNFRICAINSEGVGEPATIPGSVVAKDRLEPPEIE
LDADLRKMVILRASATLRLFVTIKGRPEPEVKWEKAEGILTERAQIEVTSSYTMLVIDNV
TRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLSVKDVKKDSVTLSWEPPLIDGGA
KVTNYIVEKRETTRKAYATVTNNCTKTTFKIENLQEGCSYYFRVLACNEYGIGLPAETSE
PVKASEPPLPPGRVTLVDVTSNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQV
KTLEATISGLTSGEEYIFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFHTFNVKA
RDQLKIDVPYKGRPQATVSWKKDGQTLRETTRVNVSSSKTITSLSIKEASREDVGTYELS
VSNSAGSITVPITVIVLDRPGPPGPIHIDEVSCDNITISWNPPEYDGGCQISNYIVEKRE
TTSTTWHVVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSTYSDSPAVVAEYPFSPPG
PPGTPKVVHATKSTMIVTWQVPVNDGGSQVIGYHLEYKERSSILWSKANKILIADTQMKV
SGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKP
HYDGGAKITGYIIERRELPDGRWLKCNFTNVQETYFEVTELTEDQRYEFRVFAKNAADSV
SEPSESTGPITVKDDVEAPRIMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGV
EIEERARTEIVSTDYNTLLTVKDCVRRDTGQYILTLKNVAGTRSVAVNCKVLDKPGPPAG
PLEIYGLTAEKCSLSWGPPQENGGADIDYYIVEKRETSRLAWTICEGELRTTSCKVTKLL
KGNEYIFRVTGVNKYGVGEPLESVAVKALDPFTVPSPPTSLEITSVTKDSMTLCWSRPES
DGGSEISGYIIERREKNSVRWVRVNKRPVYDLRVKSTGLREGCEYEYQVYAENAAGLSLP
SEASPLIRAEDPVFLPSPPAKPKIVDSGKTNITISWVKPLFDGGAPVTGYTVEYKTSDET
DWKTAIQNLRGTEYTISGLTTGAEYVFRVRSINKVGASDPSDSSDPQIAKEREEEPVFDL
DSEMKKTLIVKAGASFTVTVPFRGRPVPNVSWSKPDTDLRTRAYIDSTDSRTSLTIENAN
RNDSGKYTLTIQNILSAASLTLVVKVLDSPGPPANISVHDVTKESAVLSWDVPENDGGAP
VKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGQNEFGVGVPAETKDG
VKITEKPSPPEKLGVTSVSKDSVSLTWLKPEHDGGSRIVHYIVEALEKGHKNWFKCAVVK
STHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSQTVYV
RAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVAADAGRYE
ITAANSSGTTKTFINIIVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYIVL
KRETSTAVWTEVSATVARTTIKVMKLTRGEEYQFRIKAENRFGISDHIDSACVVVKLPYT
TPGPPSTPWVTNVTQESITVSWHEPVSNGGSAVIGYHLEMKDRNSILWQKVNKMIIRTTH
FKVTTISAGLIYEFRVYAENAAGVGKPSHASEPVLAIDACEPPRNIRITDISKNSVSLSW
QQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVIETQFIVSGLTQNSQYEFRVFARNAI
GSISNPSEVVGPVTCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPEPTIEWFK
DDKELQTNALLCVENTTDLASILIKDANRLNSGRYELKLRNAMGSASATIRVQILDKPGP
PGGPIEFKTVTAEKITLLWRPPVDDGGAKITHYVVEKRETSRVVWSMVSENLEECIITTT
KIIKGNEYVFRVRAVNKYGIGDPLESDPVVAKNAFVTPGPPSIPEVTKITKNSMTVVWNR
PVADGGSEISGYFLEKRDKKSLGWFKVLKESIRDTRQKVAGLTENSDYQYRVCAVNAAGQ
GPFSEPSDFYKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVAMRQG
EEEEWTVVSTKGEVRTTEYVVSNLKPGVNYYFQVSAVNCAGQGEPIEMTEPVQAKDILEE
PEIDLDVALRTSIIAKAGEDVHVFIPFKGRPPPTVTWRKDEKNLGSDARYSIQNTDSSSL
LIIPQVTRNDTGKYILTIENGVGQPKSSTVSVKVLDTPAACQKLQIKHVSQGTVTLFWDP
PLIDGGSPIINYIIEKRDATKRTWSSVSHKCSSTTFKVKDLSEKTPFFFRVLAENEIGIG
EPCETTEPVKAAEVPAPIRDLSVKDSTKTSVTLSWTKPDFDGGSVITEYVVERKGKGEQT
WSYAGISKTCEIEVGQLKELSELEFRVSAKNEKGLSDAVTIGPVTVKELVITPEVDLSEI
PGAQVAVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEYVRFSKTENKITLSIKNVKK
ENGGKYTVILDNAVCRTSVPITIITLGPPSKPKGPVRFDEIKADSVIMSWDVPDDDGGGE
ITCYSIEKREASQKNWKMVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSTII
VAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGAEVTGFHVEKKERNSILWQRINT
SPISGREYRATGLMEGLDYQFRVYAENSAGLSAPSDPSKFTLAVSPVDPPGTPDYIDVTR
ETITLKWNPPLRDGGSKIVAYSIEKRQGSDRWVRCNFTDVSECQYTVTGLSPGDRFEFRI
IARNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLTIKSGESLRIKALVQGRPVP
RVTWFRDGVEIEKKMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNVSGTAKAEIKVKV
QDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDNCET
LSYTAVKLITGNEYQFRISAVNKFGVGRPLDSDPVVAQIQYTIPDAPGTPEPTNVTGNSI
TLTWARPESDGGNEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVM
AENDAGVGPPSGISRLIKCREPVNPPSAPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGY
IIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKA
VDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWTKPDSNLSIRADIHTTE
SFSTLTVENCNRNDAGKYTLTVENNSGSKSVTFTVKVLDSPGPPGPITFKDVTRGSVTLM
WDAPLLDGGARIHHYVVEKREASRRSWQVVSEKCIRQILKVNDLVEGVPYYFRVSAENEY
GVGEPYEMPEPMVATEQPAPPKRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKG
SDFWVEAGHTKQLTFTVERLVENTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTAD
LTGITNQLITCKAGSTFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLSVK
DSMRGDSGRYFLTLENTAGVKTFTITVVVIGRPGPVTGPIEVSSVSAESCVLSWAEPKDD
GGTDITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLE
SAPIIAEHPFVPPSAPTRPEVYYVSANAMSIRWEEPYHDGGSKVIGYWVEKKERNTILWV
KENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPMMAQNPVDAPGRPEVT
DVTRSTVSLIWSSPVYDGGSKIVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSE
GDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLQGDLVTIRAGSDLVLD
AAVGGKPEPKIIWTKGDKELDLCEKISLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGT
KAVSVLVKVLDSPGPCGKLTVSRVTEEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWV
IVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSQPGMPEE
VGAGKEHIIIQWVKPESDGGNDISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTGLMEG
CDYQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYD
GGVDITGYVLEMQEKGTDQWYRVHTNATIRNTEFTVLDLKMGQKYSFRVAAVNVKGMSEY
SESTAEIEPVERLEIPDLELADDLKKTVTLRAGASLRLMVSVSGRPPPVITWSKKGIDLA
SRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKE
VSRDSVTITWEIPTIDGGAPVNNYIIEKREAAMRAFKTVTTKCSKTLYRISGLVEGCMYY
FRVLPENIYGIGEPCETSDAVLVSEVPLVPTKLEVVDVTKSTVSLAWEKPLYDGGSRLTG
YVLEACKAGTERWMKVATLKPTVLEHTVISLNEGEQYLFRVRAQNEKGVSEPREIVTAVT
VQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESDRVTVE
THTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIEATS
VTISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRQTFKFTRLTEGNEYVFRVAA
TNRFGIGSYLQSEVIECRSSISIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIV
ERKEVRADRWVRVNKVPVTMTRYRSTGLIEGLEYEHRVTAINARGTGKPSRPSKPIVAMD
PIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTK
IREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFV
RQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTELVIKEADRDDSGTYDLV
LENKCGKKAVYIKVRVIGNPNTPEGPLEYDDIQARSVRVSWRPPADDGGADILGYILERR
EVPKSAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVIPKTPLNP
PEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERRETSTDKWVRHNKTQITTTM
YTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVT
LQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKDRIKDRQFTIGGLLEATEYEFRVFAE
NETGLSRPRRTAMSVKTKLTSGEAPGVRKELKDVTTKLGEAAQLSCQIVGRPLPDIKWYR
FGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCMATNEVGEVETSSKLLLQATPQF
HPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAITWFHGQKLLQNSENITIENTEHYTHLVM
KNVQRKTHAGKYKVQLSNIFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSVVISWKPPA
DDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISD
PLEVPSVVIIKSPFEKPSAPSKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQ
NKWIAVTTDEIRETVFSVQNLIEGLEYEFRVKCENLGGESEWSEISEPVTPKSDVPIQAP
HFKEELRNLHVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLI
IAAVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIK
IPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFG
IDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERW
IRVGQARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRAMNYDEEV
DETREVSMTKASHSSTKELYEKYMIAEDLGRGQFGIVHRCVETSSKKTYMAKFVKVKGTD
QVLVKKEISILNIARHRNILYLHESFESMEELVMIFEFISGLDIFERINTSAFELNEREI
VSYVRQVCEALEFLHSHNIGHFDIRPDNIIYQTRRSSVIKIIEFGQARQLKPGDNFRLLF
TAPEYYAPEVHHHDLVSTATDMWSLGTLVYVLLSGTNPFLAETNQQIIENIMNAEFTFDE
EAFREISLEAMDFVDRLLVKERKSRMTASEALQHPWLKQKTEKVSTKVIRTLKHRRYYHT
LIKKDLNMVVSAARISCGGAIRSQKGVSVAKVKVASIEIGPVSGQIMHAVGEEGGYVKYV
CKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVATMYVKHITKFDDGTYRCKVVNDYG
EDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVR
FGVTITVHPEPRVTWYKSGQKIKPDDDDKKYTFESDKGLYQLTISSVTLEDDAEYTVVAR
NKYGEDSCKAKLTVTPHPPPTDTTLRPMFKRLLANAECQEGQSVCFEIRVSGIPAPTLKW
EKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERL
RYVKHEYKSKEERERHVQRQIDKTLRMAEILSGTESVPLTQVAQEALREAAILYKPAIST
KTVKGEFRLETEEKKEERKLRMPYEVPEPRKYKQTTIEEDQHIKQFVPMSDMKWYKKIRD
QFEMPGKLDRVVQKRPKRIRLSRWEQFYVMPLPRFTDQYRPRWRIPKLSQDDLEMVRPAR
RRTPSPDYYFYYRPRRRSLGDISDEELLLPIDDYLAMKRTEEERLRLEEELELGFSASPP
SRSPPRFELSSLRYSSPQAHVRTEETRKDFRYSTYHIPVKAETSTSYAELHERHARASYR
QPKQRQRIMAEKEDEELLRPVTTTQRLSAYKSELDHISKEEKSRKKSRQQREVTEITEIE
EEYEISKHAQRETSSSVSRLLRRRRSLSPTYIELMRPVSELIRRRPQPAEEYEDEYEDDT
ERRSPTPERTRPRSPSPVSSERSLSRFERSARFDIFSRYESMKAALKTQKTSERKYEVLT
QQPFTLDHAPRITLRMRSHRVPCGQNTCFILNVQSKPTAEVKWYHNGVELQESSKIRYTN
MSGVLTLEILDCHIDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASQRRDEDVPRSV
FPELTRIEAYAVSSFKKTSEMEASSSVREMKSQMTETRESLSSYEHHASAEMKSAAIEEK
SLEEKSTHRKIKTTLAARILTKPRSITVYEGESARFSCDTDGEPVPTVTWLRGGQVISTS
ARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSDGKQAAQFTLTIQKARVTEKAVTAPP
RVKSPEPRVKSPEGVKSPKRVKSPEPVTSHPKAVSPTETKPTATEKLQQLPVSAPPRITQ
SLKAEASKDIAKLTCAVESSILSAKEVTWYKDGKKLRENGHFQFHYSADGTYELKIHNLT
ESDCGEYVCEISGEGGSSKTNFQFTGQAFKSIHEQVSSIAETKKSAQKTAESTETKKSVQ
KTAESTETKKTAQKTTESTETKKTAQKTAESTETKKTEPKAPEPISSKPVIVTGLQDTTV
SSDSTAKFVVKVTGEPRPTVIWTKDGKAITQGGKYKLSEDKGGFLLEIHKTETSDGGLYT
CTITNSAGSVSSSCKLTIKAVKDTEAQKVSTQKTSEITSQEKAVVQEEISQKALISQEIK
KSEVKSQEKLAMKEEASKVLISEKVKKSEAASLDKSIVHEEISKTSQASEEIRTQAEVKA
FSTQMSINDGQKVTLKANIAGATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQAGHKD
AGILTCIGKTSQGIVKCQYDLTLSKELSDAPAFISQPRSQNVNEGQNVLFSCEISGEPSP
EIEWFKNNLPISISSNISVSRSRNVYSLEIRNASESDSGKYTVKAKNFRGQCSATASLTV
LPLVEEPSREVVLRTSGDTSLHGSFSSQSMQMSASKQEASFSSFSSSSASSMTEMKFASM
SAQSMSSMQESFVEMSSSSFMGKASMTQLESSTSRMLKAGIRGVPPKIEALPSDISIDEG
KVLTVACAFTGEPTPEITWSCRGRKIKNQEQQGRFLIENTDDLTTLIIMDVQKQDGGIYT
LSLGNEFGSDSATVNINIRSI
NT seq 100326 nt   +upstreamnt  +downstreamnt
atggcaactcaagcaccgacgtttacgcagccgttacagagcgttgtggtactggagggt
agtaccgcaaccttcgaggctcacgttagtggtttgccagttcctgaggtgagctggttt
agggatggccaggcaatttccacttccactctgcccggcgtgcagatctcctttagcgat
ggccgcgctagactgacgatccccgccgtgactaaagccaacagtggacgatactccctg
agagccaccaatggatctggacaagcgactagtactgctgagcttctcgtgacagccgag
acagcgccacccaacttcgttcaacggctgcagagcatgactgtgagacaaggaagccaa
gtgcgactccaagtgagagtgactggaatccctacacctgtggtgaagttctaccgggac
ggagccgaaatccagagctcccttgatttccaaatttcacaagaaggcgaactctacagc
ttactgattgcggaagcatacccggaagactccgggacctattcagtaaatgccaccaac
agcgttggaagagctacttcgactgccgaattgctggttcaaggtgaagaagtagtaccc
gctaaaaagacaaagacaattgtttcgactgctcagatttcagaaacaagacaaacccgg
attgaaaagaagattgaagcccactttgatgccagatcaatcgcaacagttgagatggtc
gtagatgggcaacagctgccacataaaacacctcccaggatacctccgaagccaaagtca
aggtctcccacaccaccatccattgctgccaaagcacagttggctcgacagcagtcccca
tcgccgataagacactcgccttccccggtcagacatgtgcgagcaccgaccccatctccg
gtcaggtccgtgtctccagctgggaggatctccacgtcgcccatcagatctgtgaagtcg
ccattgctcgtccgtaagactcagacctccaccctggcccaaggccctgaagtgcctcct
ccttggaagcaagagggctatgtggcctcatctgaggctgagatgagagaaacgacggtg
acaagcgcgactcagatcaggacagaggagagatgggaagggagatacggagtccaggag
gaagtgaccatcagcggagctgcgggcgccgctgccagcgtgtcggtcagcgctgccttc
gcggcaggtgctgtcgccacgggtgctgcagaggtgaaacaagaaactgacaaaagcgca
gctgttgcgaccgttgttgctgctgttgatatggccagagtgagagaaccagttatcagt
gctgtagagcagactgctcagaggacaaccacgactgccacgcacatccaacctgctcaa
gaacagataagaaaggaggcagagaagactgctgtaactaaggtagtagtggccgccgat
aaagcgaaggaacaagaattaaaaagaaccagagaagtaattacgacaaaacaagagcag
gtgcacgtaactcacgaacagataagaaaagaaactgaaaaagcatttgtaccaaaagta
gtaatttctgcagctaaagccaaagaacaagaaactagaattactggagaaattactaaa
aaacaagaacaaaaacaaataactcaagaaacgataatgaaagaaactaggaaaacagtg
gtacctaaagtcatagttgccacacccaaagtgaaagaacaagatttagtatcaagaact
agagaaggcatcactaccaaaagagagcaagttgaaataactcaggaaaagatgagaaag
gaagctgagaaaactgccttgtctacaatagcagttgcaactactaaagccaaagaacaa
gaaacaatactgagaactagagaagcaaaggctactagacaagaacaaatccaagttacc
caagaaaaggtggacgttgggaaaaaggctgaagctgtagcaacagttgttgctgcagta
gaccaggcccgtgttagagagcccagagcacccgcgcatcttgaagaatcgtatgctcag
cagactactttggaatatggatacaaggagcacatttctgccacaaaggtagctgagcat
ccccagcgtccggcctcagaaccccacgttgtccctaaagcagtcaagcctagagtaatc
caggttccttctgagactcatgtcacaactactgatcaaatgggaatgcagatatcatca
cagatcaagaaaactacagatctaacaactgaaagattagtccatgtggataaacgcccc
cgcacagcaagccctcactttaccgtttcaaagatttctgttcctaagacagatcatgga
tatgaggcatcaatagcaggcactgctattgccacattacaaaaagagttgtcagccaca
tctcctgctcagaagatcaccaaatcggtgaaggcacccacggtgaagcctgctgagacc
agagtgagagcagagcccaccccctcacctcagttcccctttgctgacataccagagact
tacaagagtcaagctggcattgaagtgaaaaaggaagtaggggtgagcatcgctggtgcc
accgtccgtgaagagcactttgaagtactgcacggacgtgaagtcaaggtaacagaagca
gcaagagtgcctgcacctgttgaaattcctgttactccaccaactttggtctcgggctta
aaaaatgtgactgtcatagaaggtgaatctgtcaccttggagtgccatatatctggatac
ccatccccaaaagtgacgtggtacagagaagactaccaaatagaaagttccattgacttc
cagataaccttccagagcggaattgctcgtctgatgatccgagaagcctttgcagaagac
agcgggcggtttacttgcagtgctgtgaacgaggctgggaccgtcagcacatcctgctat
ctagctgtgcaggcatcagaagagtttgaaaaggaaacaacagctgtggctgagaaagtt
accacagaagagaaacgctttgtggaatcaagagatgtggtaatgactgataccagcatc
acagaggaaatagcaggacccggagaacctgccgctcctttctttattacaaaaccagtg
gtccagaaactggtggaaggtgggagcattgtgtttgaatgccaagttggcggcaaccca
aagccccatgtctactggaaaaaatctggggttcctctaaccagtggatacagatacaaa
gtgagttacaataaacaaaccggtgagtgcagactggtgatttcgatgacttttgctgat
gatgctggagaatacacgattgttattcgtaacaagcatggagaaacttctgcatctgcc
tccttgctcgaagaagctgaatatgagtcactggtgaagtcccagcaagaaatgctttac
cagacacaaatgactgcattcgtgcaagaacctaaagttggagaaatagcacctggattt
ctatactctgagtatgaaaaagaatatgaaaaagaacaggccttaattaggaagaaaatg
gccaaagatactgtaatggtcagaacttttgtagaagaccaggaattccacatttcttcc
tttgaagagagactcattaaagaaattgaatacagaataataaagactacattagaagaa
cttcttgaagaagatggagaagaaaaaatggcagtggacatttctgaatctgaagccatt
gaatcaggatttgaattacgagtcaagaattatagaattcttgaggggatgggtgttaca
tttcattgcaagatgtctgggtatccgctacccaagattgcatggtacaaagatggcaag
cgcatcaaacatggagagagataccaaatggactttctacaagacggcagagccagtctg
cgcatacccgttgttcttccagaagatgaaggcatctatactgcatttgccagcaatatt
aaaggaaatgcgatttgctcagggaaattgtatgtggagcctgctgcaccacttggtgct
ccgacttacatacccacaccagagccagtgagcagaatcagatctgtctctccacgttca
gtgagcagatctcctatacgcatatctcctgcacggatgtcccctgcaaggatgtctcct
gcacggatgtcccctgcaagaatgtcccccggacgtaggctggaggaaacagatgagtca
caacttgagagactgtataagccagtcttcgtgttaaaacctgcttctttcaaatgttta
gaaggacaaactgccagatttgacttgaaggttgtgggtagacctatgccagagaccttc
tggtttcatgatggccagcaaattgtcaatgactacacccataaagtagtcattaaagaa
gatggcacccaatcactgattattgtccctgcagcacccagtgattctggggaatggact
gtggttgcccaaaacagggcaggcagatcttcaatttcagtaatgttaactgtggaagct
gtggaacatcaggtaaaaccagtgtttgtggaaaaactgaaaaatgtcaatgtaaaggaa
ggttctcgacttgaaatgaaagtcagagctacgggtaatcccaaccctgacattgtatgg
ttgaaaaacagtgacatcattgtacctcataaatatccaaaaatcagaattgaaggaacc
aagggagaagcggcccttaaaatcgattctactgtcagccaagattctgcctggtatact
gccactgctattaataaagctggccgagacactacaagatgcaaagtcaatgttgaagtt
gagtttgcagagcccgaaccggaaagaagattaatcatcccaagaggaacatacagagca
aaggagattgcagcccctgaactggagcccctccatttgcgatatggtcaagaacaatgg
gaagagggtgacctctatgacaaagagaaacaacagaagccatttttcaagaaaaaactc
acttccttaagactcaagcgcttcgggcctgcccactttgaatgcaggctaacaccaatt
ggtgacccaacgatggtggtagaatggcttcatgatggaaagccacttgaagcagccaat
aggcttcgtatgatcaatgaatttgggtattgcagccttgattacggagttgcatataat
agggacagtggtgtcattacttgcagagccactaacaaatatggaacagatcacacatct
gctacccttattgttaaagatgagaaaagtcttgtggaagaatctcaattgcctgagggg
aggaaaggcttacagagaattgaagaattagagaggatggctcatgaaggtgcacttaca
ggtgtaacaacagatcagaaagagaagcaaaagccggatatcgtcttgttcccagagcca
gtaagagtacttgaaggggagaccgctagattccgttgccgagtgacaggttaccctcag
cccaaagtcaactggtacctcaatggacagctcatccgcaaaagcaaaaggttcagagtt
cgctatgatggcattcattatctggacatcgtggactgcaaatcatatgatacaggtgaa
gtcaaggtcactgcagaaaatcctgaaggtgtgatagagcataaagtgaaacttgagatc
caacagagggaagatttcaggtctgtccttaggcgagctcctgaaccaaagcctgagttt
cacgtacatgaacctggaaaacttcagtttgaagtacaaaaggtagatagacctgttgac
accacagaaaccaaggaagttgtgaggttgaagagggctgaaagaattacccatgaaaaa
gtgtctgaagagtcagaagagctgcgcagtaagttcaagcgcagaacagaggagggatat
tacgaagccattactgctgtagagcttaagtctcgaaagaaggatgaatcctatgaagaa
ctcctgaggaagacaaaagaggaacttctccactggaccaaagagttaaccgaagaggag
aagaaagcccttgccgaggaaggcaaaatcactattccaacttttaaacctgataaaatt
gaactaagtcctagtatggaggctcctaaaatctttgaaagaatccaaagccaaacagtg
gggcaaggatctgatgctcacttccgggtcagagttgtgggaaaaccagatcctgaatgc
gaatggtacaaaaatggtgtcaaaatcgagcgctctgaccgaatctactggtactggcct
gaagacaatgtttgtgaactggtcataagagatgtgactgctgaggactctgccagcatc
atggtcaaagccatcaacatagctggggaaacctcaagccacgcattcttactcgtccaa
gccaagcaattgatcactttcacacaggaattacaagatgttgttgctaaggaaaaagac
accatggcaacctttgaatgtgaaacttcagagccatttgttaaagtgaaatggtataaa
gatggtgtggagattcataagggaaataaatataggatgcactctgacaggaaagttcac
ttcctctctgtgttgacaatcgacccctctgacgctgaagactacagctgtgtacttgtg
gaagatgaaaatgtaaaaacaacggctaaactgattgtcgaaggtgcagttgttgaattt
gtgaaagaacttgaggacatagaagttccagaatccttttcgggagagttagagtgcatt
atatccccagaaaatatagaaggcaaatggtatcacaatggcgtggagcttaaatccaat
ggcaaatacacaattacatctcgccgtggacgtcagaacctcacggtcaaggatgtaacc
aaagaggaccagggagaatacagctttgttgccgatgggaaaaagacaacctgtaaacta
aagatgaaaccccgccccattgctattctacaaggtcttagtgatcaaaaagtctgcgag
ggtgacatcgttcagcttgaagttaaagtctccttagagaatgtagaaggcgtctggatg
aaagatggccaagaagtgcagtccagtgacagggttttcattgtgatagacaaacagtca
cacatgctgctcattgaagacatgaccaaggaggatgctggaaattactccttcaccctt
ccagccctgggactgtcaaccagtgggcgcgtctctgtctatagtgtggatgtgataaca
cctctaaaggatgttaacgtgattgagggtaccaaggctgtgctcgaatgtaaagtttca
gtccctgatgtgacttctgttaaatggtacttaaatgatgaacaaatcaagcctgatgat
cgagtacacgccattgtcaagggcactaagcagcgactagtgattaaccgcacccatgct
tcagatgaagggccttacaagctgatggttggccgagttgaaaccagctgtgatctctct
gtagaaaaaattaaaattatcagaggtcttcgtgaccttacctgtacagaaacccaaaat
gtggtctttgaggttgagctgtcccactcaggaattgatgtcttgtggaattttaagggc
aaggaaatcaaacccaatgctaaatataaaattgaagctcatgggaaaatatataagttg
acggttttaaatatgatgaaagatgatgaaggagaatacacattttatgctggagaaaat
atgacatctggaaaacttaccgtggcagggggcgccatctccaagcctctcacagatcag
accgtagccgagtcccaggaagctgtctttgaatgcgaagttgccaacccagattccgag
ggcgaatggctaagggatggcaaacacctgcctctgagtaaaaacatcagaagtgagtct
gatggccacaaaaggagacttatcatcgctgccagcaaattggatgacattggagaatac
acctacaaggtggccacctccaaaacatctgccaaactcaaagttgaagctgtcaaaatt
aagaagactctgaagaatctcacagtaacggagacgcaggatgctgttttcactgtcaca
cttacacatccaaatgtaaaaggtgtccagtggatcagaaatggggttgtgctggaatcc
aatgacaagtacgatgtctcagtcaaaggaacaacttactctctgagaattaaaaactgt
gctgtttcggatgaatctgtttatggcttcaagctcggaaggctaggagccagtgccaga
ctgcacgttgagactgtcaagatcattaaaaagccaagggatgtgaccgccttggaaaat
gccaccgttgcctttgaagttagtgtttcccatgacacagttccagtaaaatggttccat
aagaatgtggagattaagccgagtgacaaacacagactggtctcggaaaggaaggtccac
aagctgatgctgcagcatatttccccgtcagatgctggggagtatacagctgtggtgggg
caattggaatgcaaagctaagctgtttgtggagacattacatattacaaaaaccatgaaa
aacatcgaggtgcctgagaccaaaactgcctcctttgagtgtgaggtgtcccacttcaac
gtcccttccatgtggctgaagaatggggtggagattgagatgagtgaaaagttcaagata
gtcgtgcagggaaaactccaccagctgctcatcatgaacaccagcacagaggacgcagca
gaatacacgtttgtctgcggcaacgaccaagtcagcgccaccttgaaagtgaccccaatc
atgattacatccatgctgaaggacatcaatgctgaagaaaaagacacaattacctttgag
gtgacagtgaactatgaaggcatctcttacaaatggttaaagaacggtgtggaaatcaaa
tccactgacaggtgccagatgagaaccaaaaagctcacacactcattgaacatcaggaat
gttcactttggagatgctgctgagtacacctttgtggctggaaaagctacgtcgacagcc
acactttatgtggaagctcgtcatatagagtttaggaaacacattaaggacattaaggtt
ctcgagaagaagagagccatgtttgaatgtgaagtctctgaacctgacatcactgtgcag
tggatgaaggacggtcaagaactgcagattgtggacagaataaagatacaaaaggagaaa
tatgtccaccgccttctgatcccatccacccggatgtccgatgctgggcagtacacagtg
gtggcaggaggcaacatgtccaccgctaacctctttgtcgagggcagagatgttcgcatc
cgaagtattaaaaaggaggttcaggttattgagaaacaacgtgctgtcgttgagtttgag
gtcaatgaagatgatgttgatgcccactggtataaagatggaattgaaatcaatttccaa
atccaagaacgacatcaatatgtggtggagagaagaatccaccgaatgttcatctctgag
accaggcacagtgatgccggtgaatacacctttgtggcaggaaggaacaggagttctgtt
actctttatgtcaatgctccggaaccaccccaaattctgcaggagctccagcctgttact
gtgcaatctggcaagcctgcccgcttctgtgctgtgatatccggcagaccgcagcccaaa
atttcttggtacaaggaagagcagctgctttccactggcttcaagtgcaaatttcttcac
gatgggcaagagtacacgcttttgctaatcgaagccttcccagaggacgcggctgtctac
acctgtgaagccaagaatgactatggagttgcgacgacctcagcttcactctcagtggaa
gttccagaagttgtgtctcctgatcaggaaatgccagtttatcctcctgccatcatcacc
ccgcttcaggacactgtcacttctgagggacagccagcccgttttcaatgcagcgtttct
ggaacagatctcaaagtgtcttggtacagcaaagacaagaaaatcaagccatctcggttc
tttagaatgactcagtttgaagacacttaccagttggagattgctgaagcttatccagaa
gatgaagggacttacacttttgctgctagtaatgccatgggtcaagtatcgagcacagcc
aacttgagactggaagcccatgaatcgcttttacatgagaggattgaagaacagattgag
gtggagatgaaagctgctccagtgctcaggaggagaattgagccccttgaagtggctctg
ggccatctagccaagttcacctgtgagatccagagtgcccccaatgtgcggttccagtgg
tttaaggctggccgacaaatttacgacagtgacaagtattctatccgatcttcaaagtat
gtctccagcctggaaatcctgagatcccaggttgttgactgcggcgagtacacctgcaaa
gcttccaatgagtatggcagtgtcagctgtacagccacactgaccgtgacagaggcatat
ccaccaaccttttactccagacctaaatccgttacaacttttgtgggtaaggcagccaag
ttcctctgcacagtgctaggaactcctgtgattgaaaccgtttggcagaaagatggcgcc
gcgctatcaccttctcctaactgcaagatttcagatgcagaaaacaaacacattttagaa
ctctcaaatcttacaatacaagaccaaggagtttactcttgtaaggcttccaacaagttt
ggagccgacatctgccaagctgagttgatcataatcgacaaaccgcatttcattaaagaa
ttagagcctgtgcaatcggctatcaataagaagatccaccttgagtgccaagtagatgaa
gacagaaaagtcacagttacatggaagaaggatggtcaaaaactgccccccgggaaagat
tttaagatctattttgaagataaaatagcatcacttgagatccctctggccaaagtaaaa
gattcaggaacctatgtttgcacagcttccaatgaggcaggcagcagctcctcttcagca
acggtaaccatcagagagccaccatcctttgtgaagaaggtagagccctcttatttaatg
ctccctggtgaatcagcccgcctccattgcaagctgaaaggctcacctgtgatccaggtt
acttggtttaaaaataacaaagaacttaatgagagtaacacaatccgaatgtcttttgtc
aattctgaggctgtacttgatattacggatgtgaaagttgaagacagcgggagttactcc
tgtgaagccgtgaatgacgtgggcagtgacagctgcagtgctgaaatagttgtcaaagaa
cctccttctttcatcaaaactctcgagcctgcagatatagtgagaggatcaaatgccctc
cttcagtgtgaagtcgcaggcactggaccatttgaaattagctggttcaaagataagaag
caaattcgaagtagtaaaaagtacaggttgttttctcagaagtctcttgtgtctctggag
atctttgcttttaacagtgccgatgttggtgaatatgaatgtgtcgttgctaatgaagtt
gggaagtgtggctgccttgcaacacacttattaaaagaaccaccaacctttgtaaagaaa
gtagatgattttaccgcactagcaggacagactgttaccttacaagctgctgtgagaggg
tcagaacccatttctgtcacatggatgaaaggacaagaggtcattaaagaagatggaaaa
atcaaaatgagcttttccaatggtgttgccgtcttgataatccccgatgttcagattagt
tttggtgacagatacacatgcctggctgaaaacgaagccggaagccaaacgtctgtaggg
gaattaatagttaaagaacctgccaaaatcattgagagagcagagctgatccaggtgaca
gcgggggacccagccacactggagtatacagtcacaggcaccccagaactcaagcccaaa
tggtacaaagatgggagacctttgattgctagtaaaaagtatcgaataagttttaaaaac
aatgttgcccaactcaaattttattcggctgaactgcatgatagtggccaatacacattt
gagatttccaatgaagtgggcagcagctcctgcgagacaactttcactgtattagatcga
gacattgctccgttttttaccaaacccctacgcaacgtggatagcattgttagtggtacc
tgcaggctggactgcaaaatcgctggctccctccccatgagggtatcttggtttaaggat
ggcaaagaaatagcttcttctgacagatacagaatagcatttgtggaaggcacggcctct
ttggagataagcagagtagacatgaatgacgcggggaatttcacttgtcgagccacaaat
tctgtgggaagcaaagacagcagcggagccctgattgtgcaagaaccacccagttttgta
accaaacccgcatcaaaggatgttctgcccaactctgcagtctgcctgaagagcaccttc
caggggtctgctcctttcacagtcagatggtttaagggtgacaaagagctggtttctggt
ggaagctgctatattaccaaagaagctttagaaagttccctggaactctatgcagtaaaa
acctctgattcaggcacatacacctgtaaaatcagcaatgtcgctggaagcgtggagtgc
agtgcaaacttatttgtaaaagaacctgccacctttgttgagaagttagagctatcacag
ctattaaagaaaggagacaccgccgagctagcctgcaaagtaactggtacccctccaatt
aaaataacatggtttgtgaatgatagagaaattaaggaaagcagcaagcacagaatgtct
tttgtggaatccagtgcggtcctaagactcacagatgttgccactgaagacagtggcgaa
tacatgtgtgaggctcaaaatgaggctggcagtgaccactgcacaggcgttttaatagtc
aaagaggcaccttactttaccaaggaatttaagccaatcgaagtgttgaaggagtacgat
gtcatgttgctggccgaggtggcaggcactcctccctttgagatcacttggttcaaagac
aacacaacgctgcgaagtggtagaaagtataaaaccttgattcaggatcagctggttagc
ctgcagatcctcaagtttgtagccgcagatgctggcgaataccagtgtcgggtgaccaac
gaggtgggcagcagcacctgcagtgccagggtgactttaagagaacccccaacctttgta
aagaggatcgagagcaccagctctcttcgaggaggcacagctgccttccaggcaactctg
aagggctccttgccaatcacggtgacttggttaaaagacaatgatgaaatcactgaagat
gaaaatataagaatgacctttgagaacaatgtggccagtctgtacctcagtggcattgaa
gtcaagcatgatggcaaatatgtctgtcaggccaaaaatgatgcaggaatacaaagatgt
tctgcattactctcagtaaaagaacctgcaacaatcaccgaggaggctgtgtctatagat
gtcacccaaggagacccagccaccttgcaggttaaattttcagggactaaggagattaca
gccaaatggtttaaaggtggccaagaactgaccctgggccaaaaatataaaatcagtgtc
actgacacagtctctatactgaagattatttctactgaaaagaaagatagtggagaatac
acttttgaggtccaaaatgacgttgggagaagcagctgcagggctagcattaatgtatta
gatcttattatacctccctcattcaccaaaaagctgaagaaaatggacagcattaaaggg
tcttctattgatttagaatgtatagtcgctgggtcacatcccataagcatccaatggttc
aaagatgaccaagaaatatcagctagtgaaaaatacaaatactcttttcatgacaatact
gccttcttggagatcagtcacctggaaggtacagacagtgggacatacacttgttctgcc
actaataaggcaggacacaaccagtgcagtggccatctgacagtcaaagaacccccttac
ttcgtagaaaagcctcagtcacaagatgtcaatcccaacacaagggttcagttaaaggct
cttgtgggtggcactgcgcccatgacaataaagtggtttaaagacaacaaagagttgcac
tcaggagcagctcgctcagtttggaaggatgacacctccaccgttctcgagctcttttca
gccaaagctgccgactctgggacctacatttgccaactaagcaatgatgttggcacagtg
accagtaaagtcactctctttgtgaaagaacctcctcaattcattaagaagcccagccca
gtcttggtgctgaggaatggacaatctacaacattcgaatgccaaataacaggcactcct
gaaatcagagtttcttggtatctggacgggaatgaaataacagccattcggaaacatggc
atttccttcgttgatggtttagccactttccaaatttctggtgccagggtagaaaatagt
gggacttacgtctgtgaagctcgtaatgacgcaggcacagcaagctgcagcattcaatta
aaagtgaaagaacctcccacctttatcagggagctgcagccagtggaagtagtgaaagac
agtgacgtggagctggagtgtgaagtgatgggaacatctccatttgaagtcacttggctg
aagaataatagggaaattcgaagcagcaaaaaatataccctgagtgacagagtatcagtg
ttttacctccatataaccaagtgtgacccttcagacactggtgaataccagtgcataata
tccaatgaaggtggcagctgctcatgcagtgctagagtctccttgaaagagccaccatca
ttcattaagaagatagaaaatgtcactactgttttgaaaagttctgccacatttcagagc
accgtggcaggctctcctctcatttctgtaacctggctgaaagatgatcagattcttgat
gaagacgataatgttcatatttcatttgtgaacaatgtggccacacttcagatcagaact
gtggataatggacacagcgggagatacacgtgtcaagccaagaacgagtcaggagttgag
aggtgttatgctttccttttagtacaagaacctgctcagatcatagagaaagctaaatct
gttgatgtcaccgagaaagacccagtgaccttggagtgtgttgtggcgggaacaccagaa
ctcaaagtgaaatggcttaaagatgggaaacaaattgtgcccagtagatacttttcgatg
agttttgaaaataacgtggccagcttcaggattcagtcagtaatgatgcaagacagtggt
cagtatactttcaaggtggaaaatgactttggaagcagtagctgtgatgcctacctgcgt
gtgctagatcaaaatattcctccatcattcaccaaaaaattaaccaaaatggataaagtt
ctgggctcttctgttcatatggagtgcaaggtttctggctcacttcctattagtgctcag
tggtttaaggatggaaaagaaatatctacaagtgcaaaatacagacttgtctgtcacgag
aacactgtgtcactggaagttaataatctggaattagaagatactgcgaattacacatgc
aaggtctcaaatgtagcaggggatgacgcatgcagcggcatcttaactgtgaaagaaccg
ccaagcttcctggtgaaacctgagcgacaacaagccatacctgattctacagtggaattc
aaagcagtactgaaaggaacaccaccatttaaaatcaagtggtttaaggatgatgtggaa
cttgtctctggacctaaatgcttcattggcttggaagggtcaactagcttcttaaatctc
tattcagtggatgcttccaagactggacaatatacttgccaagttaccaatgatgttggt
agcgactcttgtactacacttttgttcgtgacagaaccaccaaagtttgtaaagaaatta
gaagcatccaaaatagtgaaagcaggtgactcagcacgacttgaatgcaagataactgga
tccccagaaataagagttgtgtggtacagaaatgagcatgaactcccagccagtgataaa
tacagaatgactttcattgactcagttgccgtcattcagatgaacaatctcgggactgaa
gacagtggggatttcatttgtgaggctcagaatcctgctggcagcacaagctgcagtacc
aaggttatagtaaaagaaccacctgtttttagcagcttccctcctgtagtagaaaccctt
aaaaatactgaagttagtcttgaatgtgaactttcgggaacaccaccatttgaggtggta
tggtacaaagacaagcggcaactcagaagtagcaagaaatacaagatcgtgtccaaaaac
ttccatgcaagtatccacattctcaatgtggaaacttcagacatcggtgaatatcactgc
aaggcacagaatgaagtgggaagtgatacttgcatttgtactgtacaactgaaagaacca
ccaagatttgtgtccaaactgaacagcctcaccgttgtagctggtgagcccgccgagttg
caagcgtccatagaaggcacccagcctatttatgtccagtggcttaaagagaaggaagaa
gtgattagagaaagtgaaaacatcagaattacacttgtggaaaatattgcaactctgcag
attgcaagagcagaaccagctaatgctgggaagtatatctgccaaatcaagaatgatggc
ggaacgagggagaacatggccacattgactgttctagagcccgcagtcattgtcgagaaa
gcaggatcaatgacagtgactgtaggagaaacgtgcactctggagtgtaaggtggctggc
actcccgaactctcagttgaatggtacaaggatggaaagctgttgacaagcagccaaaaa
cacaaatttagcttctacaacaaaatctcttccttaaagattctctctgttgaaaagcaa
gatgcaggcacatacactttccaggttcaaaataatgttggaaaaagcagctgcacagct
gtggtggatgtctcagaccgaacggttcctccttctttcacacgaagactgaaagatact
ggtggggttctgggtgcttcttgcatcttggagtgtaaagtagctggatcatcacctatc
tctgttgcctggtttcatgagaaaactaagattgtcagtggagcaaagtaccaaaccacg
ttttcagataatgtctgcacgttgcagctgaattccctggactcatcagatatgggcaat
tacacatgcgtggctgctaacgtagctgggtctgatgaatgtcgtgcagtgttggctgta
caagaaccaccctcttttgtgaaggaacctgaacctttggaagtactaccaggcaagaat
gtcaccttcacaagtgttattagaggaacctctcccttcaaggttggctggttcagaggt
gccagagaactggtgaaaggagacaggtgcaacatctattttgaagacactgtggcagag
ctggaattatttaatgtcgacatatctcagagtggggaatatacctgtgtggtttctaac
aatgctggccaaacattctgcactactcgtctctatgtaaaagaaccagctgcatttgtg
aagaagttaagcgatcattcggtagaaccggggaagtcgataattctggagagtacctac
actggaacacttccaatttcagttacctggaaaaaggatggttttaacataactccatct
gaaaaatgcaacatagtcacaacagagaaaacttgcctcctggaaattctgaatagcaca
aaaagagatgcaggacagtattcctgcgagattgaaaatgaggcaggaaaggatgtgtgc
gaagctctggtatctaccttagaaccaccttattttgttacggaactggaacctctggag
gcctcggtgggcgattcagtttctttacaatgccaagttgctgggacaccagaaattaca
gtgtcttggtacaaaggagacaccaagttacggccaactcctgaatacaggacctatttt
acaaacaatgtggccacacttgtttttaataaagtaaatatccatgacagtggagaatac
acatgtaaagcagaaaatagtataggaactgcttcttctaagactatcttcagaattcaa
gagcgccaactcccaccttcctttgcaagacaattaaaggacatcgaacaaactgttggg
ttaccggttacactcacttgtcgattaaatggctctgcacccatccaagtgagctggtac
agggatggggtactcttaagagatgatgaaaatctacagacatcatttgtagataacgta
gcaactttaaaaattttgcaaacggacttgagtcactctggccagtactcttgctcagct
tctaatccacttggaacagcatcttcaactgctagactgacagcaagagaacctaagaaa
tctcccttctttgacatcaagcctgtatctatagatgttatagctggggaaagtgctgac
tttgagtgtcatgttactggtgctcaaccaatgcgaatcacttggtcaaaagataacaag
gagatccgtcctggaggaaactatacaatcacatgtgtgggaaacactccccatttgaga
attcttaaagtaggcaaaggagactctggtcaatatacttgtcaagcaaccaacgatgtc
ggcaaagacatgtgctcagctcaactcagtgtaaaagaacctccaaagtttgttaagaaa
ttagaagcttcaaaagttgcaaagcagggagaatccacccaactggagtgcaaaataagt
ggttccccagaaatcaaagtgttgtggttccgaaatgacagtgaacttcatgaaagttgg
aagtacaacatgtcattcgttaattctgtggcattgcttaccatcaatgaagccagcact
gaggacagtggggactatatctgtgaagctcacaatggtgttggcgacgccagctgtagc
acagcgctgactgttaaagcacctcctgttttcacccagaagccttctccagtaggagcc
cttaaaggttctgatgttgtcttccaatgtgaaattgcgggaacacccccatttgaagtg
gtgtgggttaaagatcgaaagcaagttcgaagcagcaagaaatttaaaatcacttcgaaa
aattttgatacaagtcttcatatccttaatcttgaagcctccgatgtaggagaatatcac
tgcaaagctagtaacgaggtgggaagtgacacgtgtgtttgcactgtcaagttccaagaa
cctccacgatttgtgaaaaagctaagtgacacctcaacccttgttggggatgctgttgag
ttacgggctgtagtggaaggcttccagccaatttctgttgtctggctgaaagataaaggg
gaagtcatcagagagagtgaaaacactaggatttcattcattgacaatgttgcaactctc
caacttgggagcccagaagcatctaattctggaaaatatgtgtgccaaatcaaaaatgat
gccggaatgagagaatgttctgcagtcttgactgtactagaaccagccagaatcatagag
aagccagaacccatgacggtcactaccggaaatccttttgcattagagtgtgtagtgact
ggaacaccagaactttcaaccaagtggttcaaagatggaagagaattatctggagacagc
aaacatcacattacatttgtcaacaaagtggcttcccttaaaatcccctgtgcagaaatg
agtgacaagggattatatagctttgaggtgaaaaacagtgttggtaaaagtaactgcact
gtatctgtccacgtttcggatcgagtcgtccctccttccttcatccgcaagctgaaagac
ctgaacgccatcctggggtcctcagcggttttggagtgccgagtcgctggctcggccccg
atttccgttggctggtttcaggatggaaatgagatcattagtgggcctaaatgccagtcc
agcttttcggaaaatgtctgtactttgaatctgagctcactggagccctctgacacaggc
gtctacacatgtgtggctgccaacgtggctggttctgacgaatgctcagcagtcctgact
gtgcaagaaccaccatcttttgaacaaacccctgattctgtggaagttttacctggagtg
agcctcacattcaccagcgtctttagaggcacccctcctttcaaggtcaaatggtttaag
ggcagcagggaactggtgtcaggggactcatgcaccatctctctggaagattatgtctcg
gaactggagttgtttgaggtggagccactgcagagtggagactattcttgcctcgttact
aatgatgctggcagtgcttcctgtaccacacatctgtttgtgaaagaaccagccaccttt
gtgaaaagattggctgatttcagtgtggagacaggaagccccatagttcttgaggccaca
tttactggcacgccgcccatctcagtgagctggatgaagaatgaattccctctctcacag
tctcagaattgcactattaccatgacagaaaaatctacgatactggaaattcttgacagc
acgatagaagattatgcacagtacagttgcctgatagaaaatgaggctggtcaagatatt
tgtgatgctctggtgtctgtcttagaaccaccttatttcattgaacctctggaacatgtg
gaagcaaccattggagaacctacaactttacagtgtaaagtggatggaactccagaaatt
agaatttcttggtataaagaacacacaaagctacgatcagctcctgcatataagatgcaa
ttcaaaaataatgttgcctccttagtaatcaacaaagtggatcacagtgacgtgggagag
tattcatgcaaggcagaaaacagtgtgggggcagttgcttcttcagctgtgcttgtcatc
aaagatcgcaaacttccaccttcctttgcgagaaaactaaaggatgttcatgagactctt
ggcttcccagttgcatttgagtgtcgcatcaatggctcagaacctcttcaagtgtcttgg
tacaaggatggggtacttttgaaagatgattctaatttgcaaacatcttttgttcataat
gtcgcaactcttcagattttgcaaaccaaccagagccacgttggtcagtacaattgctca
gcttctaatcctcttgggactgcttcatccagtgccaagctcattctctcagagcatgaa
gttcctcctttctttgatctaaagcctgtctcagtagatctggctcttggagaaagtggt
tcttttaaatgtcatgtaactggaactgcaccaatcaaaatcacttgggccaaggataac
cgagagattcgccctggtggcaactacaagatgactttggttgaaaatactgccactctg
acagttctcaaagtaggcaaaggtgacgctgggcagtacacctgctatgcaagcaacgtt
gctggaaaagattcttgttctgctcatctgggtgtacaagaaccacccagattcattaag
aagcttgaaccttcaagaattgtgaaacaggatgaatacacaagatatgaatgtaaaata
ggagggtctccagaaatcaaagttttatggtacaaagatgagactgaaattcaagagagc
agtaaattcagaatgtcattccttgactcggtggcggtgttggaaatgcacagtctcagt
gttgaagacagcggagactacacatgtgaggcccgcaatgcagcaggcagcgccagcagc
agcacttccttaaaagttaaagaaccacccattttccgcaaaaagcctcatcctgttgag
acactgaaaggagctgatgttcaccttgaatgtgagcttcagggtactcctccgtttcaa
gtttcttggtataaagacaagagagaactcaggagtggcaagaagtacaagataatgtct
gagaacttccttacgagtattcacatcctgaatgtcgatgctgcagacattggggaatat
cagtgcaaagccacaaatgacgtggggagtgacacctgtgctggttccatcactctgaga
gcaccaccaagatttgtgaagacgctcagtgacatttctaccatcgttggtgaagaagtt
cagctgcagactgctattgaaggcgctgagccaatttcagtggtgtggttcaaagataag
ggagaagttgttagagaaagtgacaacatatggatttcttattcagaaaacattgcaacc
ctacagttttcacgagcagaaccagccaatgctgggaaatacacctgtcaggtcaaaaac
gatgctggaatgcaagagtgcttcgccacactatctgttcttgaacctgcagcaattgtg
gaaaagccagaatccatacaagttaccacgggagatacctgtaccttggagtgcacggtc
actggcacacctgaactcagcaccaagtggtttaaggatggaaaagaactgacaagtgac
agcaaatacaaaataagcttcttcaacaaagtatctggccttaagattatcaacgtggca
cccggtgacagtggagtatatagttttgaggtgcaaaatcctgttggcaaagacagctgc
acagcctcagttcgagtctcagaccgaattgttgctccttcattcacaagaaaattgaaa
gagacaaatggtctgtctggttcctcggttgtaatggagtgcaaagtctatggatcacct
ccaatctctgtctcctggttccatgaaggaaatgagatcagcagtggaaggaagtaccag
accaccctgacagataacacttgtgctttaactgtgaactcgctggaagaatcagatgct
ggcgactacacatgtgtagctactaacagggctggttctgatgaatgcagtgctcctttg
actgtgagagaaccgccatcttttgttcagaaacctgatgccatggatgttttaactgga
accaatgtaactttcacgagcatcataaaaggaacacctcccttcatggtcagctggttc
aagggtagcagtgaacttgtaccaggggacagatgtaatgtgtctttggaggattcagtt
gctgaactggagttgtttgatgtagatacaatgcaaagcggagaatacacatgcatagtc
agtaacgaagctggcaaggcttcttgtacaacacatctccatgtaaaagccccagccaaa
tttgtgaagaggctcaatgattacagcatagagaaaggaaaacacctgatcctagagggc
acctacactggaactcctcccatttcagttacatggaagaaaaatggcataaatattgct
ccttctcagaggtgtcatataaccacaactgaaaaatctgcgatcctggaaattccaagc
agcacagtagaggacgcaggacaatacaactgctacatcgaaaatgcttccggaaaagat
tcctgttcagcacaaatcctgatactagaaccaccatattttgtcaagcagttggagcct
gttaaggtgaccgttggagattctgcctctttacaatgccaacttgctgggacccctgaa
attggggtatcctggtataaaggagatacaaaattgagacccactgccacctacaaaatg
cattttaagaacaatgttgctaccctggttttcaaccaggttgatgttaatgacagtgga
gaatatatctgcagagctgaaaacagtgtgggagaagtgtcgtcatccactttcctgact
gttcaagagcaaaaacttccaccatcattttctcgacaattgagagatgttcaagaaact
gttggactgccagttgtttttgaatgtgccataaatggatcagaacctatctcagtgtct
tggtataaagacggcaaaccgttgaaagacggcccaaacgtacaaacatcgtttttagat
aatgtagccactctcaatatttttaaaacagatcggagccttgcaggccagtattcttgc
acagccacaaatccaatagggtctgcttcttctagtgccagactcattctcacagagggg
aagaacccgcccttctttgacatccccgttgcccctgtggatgctgtggtgggagaaagt
gcagactttgagtgccacgttactgggacgcaaccaataaaggtcggctgggccaaagac
aacagagagatacgaagtggtggaaactaccagattagttttctggaaaacagcgcccat
ctgacaatcctgaaagtagacaagggagactctggacaatatacctgctacgctgtgaac
gaagtgggaaaggactcctgcacagctcaactcaacataaaagagcggctcatcccacca
agtttcactaaaaaactctcagagacagtggaagaaacagaagggaattctttcagactt
gagggccgcgttgcgggttcccagcctataactgttgcttggtacaagaataatgtagag
atacatccaacttctaactgtgaaatcacatttaagaacaacacactcctgctgcaagtc
aagaaggcgggcatgggcgatgctggtttgtacacgtgcaaagtgtggaatgatgcaggc
tctgctctgtgtacatcttcaattgttatcaaagaacctcagaagccacctgtgtttgat
cagcaccttactccagtaacagtgagcgaaggtgaattcgtgcagctcagctgccacgtc
cggggttcagagccgatcaggatccagtggttgaaggctggcagggaaataaaaccctca
gacagatgcagcttcagctttgctagtggaaccgctgtgctggaactcaaggacgtgact
aaagcagattcgggagattatgtgtgcaaagcttcaaatgcggctggaagtgacacttcc
aaatcaaaagtgaccgttaaagacaaaccagctgcagtcccagccgctaagaaagcagca
gtggacgggaaactcttcttcgtatcagaacctcagagtatcagagtcgtagaaaaaacc
actgcaacattcattgccaaagttggaggtgatccaatcccaaatgttaaatggacaaaa
gggaaatggagacaactgaaccaaggaggtcgcatttttatccaccagaaaggcgatgaa
gcaaagctggagattagagacaccacgaaaaccgattctggactataccgatgcgtcgca
tttaataaacatggtgaaattgaaagtaatgttaacctacaggtggatgaaaggaagaaa
caagagaaaattgaaggagatcttagggcaatgctgaaaaagactccagtcttaaagaaa
ggagctggagaagaagaggaaattgatatcatggaacttctcaaaaatgttgatcctaaa
gaatatgaaaaatatgcccgtatgtatggaatcactgacttccggggtcttcttcaagca
tttgaactgctaaagcaaagtcaacaagaagagacacatagattggaaattgaggaaata
gagaagtcagagaaggaagaaaaggaatttgaagaacttgtatcatttattcagcaaagg
ctgtcacagacagagcctgtcactctgatcaaggatattgaaaatcagacagttttgaaa
gataatgatgctgtgtttgaaattgatattaagattaattatccagaaatcaaactctca
tggtacaaagggactgaaaaactggaacccagtgataaatttgaaataagcatcgatggt
gatcgacatacactcagagtcagaaactgtcagcttaaagatcagggcaattatagattg
gtgtgtggtccacacatcgctagtgctaaactcactgtaattgagcctgcttgggaacgg
catcttcaagatgttactttgaaagaaggccagacttgcaccatgacatgccaattttct
gtgccaaatgtaaaatctgaatggttcagaaatggcagaatccttaaaccccaaggtaga
tacaaaacagaagtggaacacaaagtccataagctgaccattgcagatgttcgagcagaa
gaccagggacagtacacctgcaaatacgaagaccttgaaacatcagcagagctcagaatt
gaagctgaaccaattcagtttacgaaacgcatacagaacattgtggtgagtgagcatcaa
tctgccaccttcgagtgtgaagtgtccttcgacgacgccattgtaacatggtacaaagga
ccaacagaactgaccgagagccagaaatacaactttaggaatgatggtcgctgccattat
atgaccatccacaacgtgaccccagatgatgaaggtgtctattcagtaattgctcgcctg
gagccaagaggtgaagcgagaagcacggcagagctgtacttaacaaccaaagaaatcaaa
cttgagatgaagcctcctgatattcctgactccagagttccaatcccaaccatgcctatc
agagcagtgccaccagatgaaatccctcctacggctattcctcctatccctctgttacta
ccagcacctgaagaaaagaaaccaccagcaaaacgtgttgaagtgaccaaaaaagccaag
aaagtcgcaaagcccaaagaagaggcaccgccgcctaaagtcccagaggttgccaagaag
cccccgcctcccactgccttaattccagccaaagctcctgaaattattgacgtatcctcc
aaggctgaagaagtaaaaataatgaccataaccagacagaaagaggttcagaaagaaaaa
gaagctgtgtatgagaaaaagcgagcagtctatgaggagaaaaaacttttcatcgaatct
ttggaagaaccatatgacgaactggaagtggaaccatacacggagccatatgaagaacct
tactatgaagaaccagatgaagactatgaagagaccaaggtagaagccagaaaggaagtt
catgaggaatgggaagaagattttgaagcagggcaagaatactatgaaagggaagaaggt
tatgacgaaggggaggaagagtgggaggagacttaccaagaaagagaagcagttcaagtt
caaaaggaggtttatgaagaaccacatgagagaaaaattccagcaaaagtgcctgaaaag
aaagaagcaccacctcctaaagttgtaaagaagccagtagttgaaaaaattgaaaagact
tctcgaagagtggaggaagcaaaagttcaagtcaccaaagtacctgaagtttcaaagaag
attgttccacaaaaaccttcccggactccagtgcaggaagaagttattgaagtgaaagta
ccagctgtgcatacagagaagatggttatttcagaagaaaagttctttgcttctcacaca
gaggaagaggtgtcagtcacagtccccaaggtacaaaagaaaactgttaccgaagagaaa
attcaagttgctgtttccaaaaagattgagcctccacctaaagtccctgagccacctcgg
aaaccagccccagaagaagtggtccctgttcccattcctaaaaaggtggaacccccacca
gccaaagttcctgaagttcccaagaaacctgtgccagaagagaaaaagcctgttcccgta
cccaagaaggaacctgctgctcccccaaaagtcccagaggtgccaaagaaacctgtccct
gaagagaaggttcctgttcctgttgcaaagaaaaaggaagctccaccagctaaagttgct
gaagtgcagaagagggttgtcacagaagaaaaagtaaccattgttactcaaagagaggaa
tctccaccaccagcagtgccagaaataccaaagaagaaagttcctgaagaaaaaagacct
gttcctcggaaagaggaagaagctccaccaccaaaagtgccagctccgcctaagaaaccc
gtcccagaggagaaagttcctgtaccagttcctgtccctaagaaagctcctcctccccga
gccgaagtgtctaagaaagctgtcgtagaagaaaaaagatattttgccgaagaaaaacta
tccgttgcagttcctcaaagaacggaagtcgtgcggcacgaagaggaggaatggagttat
tcagaagaacaggaaagagtgtccatttcagtttatagagaagaagaaagagaggaggag
gaagcggaggttacagaatatgaagtgatggaagagcctgaggaatacgttgtggaggaa
gagctgcacgttattgctgagagagtggaagctgagccagcagaagtgcctgagaagaaa
attgtaccaaaaccgaaaattcctgctaaaatagaggagccttcaccagctaaagttcct
gaaccacctaagaaaatcgtgccagaaaagaagcttcctgctgctgttcctaagaaggaa
aaggtgccaccagctaaagtgccagaagagccaaagaaaccagttccagaaaaaagggct
cctccaaaagtggctaagatagaagagcctgtccccaccaaagtgactgagaggcacatg
caaattacccaggaagaaaaagttcttgttgctgtaactaaaaaagaggagcctccaaga
gcaagagtgccagaagaacccaagagagctattccagaagagaaagttccaaaactcaaa
cctaaaaaagaggaggagccaccaacaaaagtggctgaaatcaggaaaagagctgttaaa
gaagaaaaggtatccattgaagttccaaaaagagaacctcaattcgctaaagaagtagct
gtagcagaagagaaagaatggtcttatacccgagaagaagaggttgtctcagtacaacgg
gaagaggaatatgaagaatatgaagaagaatatgattacaaagaatttgaggagtatgaa
ccaacagaagagtatgagcaatatgatgaatatgaggaacgtgaatttgaacattatgaa
gagtataaagaacgtgaagaatatgtcacagagcctgagaagcctgtcccagttaagcct
gtccaagaagaaccagttcccacaaagccaaaggccccaccagtgaaagtgccgaagaaa
gctgtccctgaagaaaaagtaccagtgcccattcctaagaaactcaaacctgtgccaccc
aaagtgactgaagaagcaaagaaagttgttgaggaaaaaatacacatttcaattaccaaa
cgtgaaaaagagcaggtgaccgaaccaactgctaaagtgcccctgaagctcaaaagggtt
gtcactgaagaaaaagtaccagttcctaaaaaggaagtagccgcacctgttagagtgcca
gaagtacctaaaagacgagaaccagaagagatagcctttgaagaggaagttgtaacccaa
gtagaggaatatcatgaagaagaagaagagtacatttacgaagaagaggaactcgtaact
gaagaagaagtggtaccagtgataccagtcaaagtgcctgaggtacccaagaaacctgtt
ccagaagagaagaaacctgttcctgttcccaaaaagaaggaagccccaccagcaaaagtg
cctgagattcctaagaagccagaggaaaaagttcctgtgcccattcctaaaaaagagaag
gctccaccagctaaagttcctgaggtacccaagaaacctgtaccagaggagaaagtgcca
gtaccagttcctaaaaaggtggaagctccacctgccaaagtgccagaagtacccaagaaa
cctgtgcctgagaagaaggtgccagttcctgttcctaagaaagtagaagctccacctgca
aaagtgccagaggtgcctaagaagatcatcccagaagaaaagaaaccaacacctgttccg
aaaaaagtggaagctccaccacccaaagttcctgaggtacctaagaaagtggaagaaaga
ccaatcgttgtccctgaagaagaggaagttccaccagttgaagtgtttgaggagcctgaa
gagcctattccagaagaagagatcccagaagaaccacctaccatagaggaggaggttgaa
gaagtagcaccacctagagtgcctgaagtggtcaagaaagcagtacctgaagcacctact
cctgttcctaaaaaagtagaggcaccaccagctaaagttccaaagaaggttcctgaggaa
aaagtacctgttcctgttcagaaaaaagaggcacctccagccaaagtgcccgaagtacaa
aagaaagtcccagaaaagaaagtcccagaaaagaaaatcccagaaaagaaagtcccagaa
aagaaagtccttgtgcctaaaaaagaagctgttcccccagctaaagatgctctttcaggg
aggactgtcgaagaaaaaatatcagttgccttccacaaagaggaagtagttagagaaaga
acagaatttgaaatagtagaagcggaagcagttcttgaggaagaagagttccatgaagtt
gaagaatattttgaagaagaagagttccacgaagtagaagaattcaccaaagtggaagag
cacagatttgaagaagtccacgaggttgaagaggtccgtagggtaatagaagttttagag
gctgaagaagtggaagtttacgaagaacccaaagctccacctaaagtgcctgaggctccc
aaggaagttgttcctgaaaagaaagtgcctgcgccacctcctaaaaagccggaagtccca
cctgttaaagtgcccgaggctcccaaggaagttgttcctgaaaagaaagtgcctgcggca
cctcctaaaaagccggaagtcccaccagccaaagtgcctgaggtgccaaaggcagctgtc
ccagaaaagaaagtgcctgaagctattcctcccaaaccggaaagtcctccccctgaagtg
cccgaggtgccgccaaaggaagtcatccctgaaaagaaagtgcctgtggctcctcctaag
aagccagaacctccacctgctaaagtgcctgaagctcccaaagaagttgttcctgaaaag
aaagtacctgtgccacgtcctaaaaagccagaagttccacctgtcacagtgcccgaagct
cctaaggaagttgttcctgaaaagaaagtgtctgtggcacctcctaaaaagccagaagtc
ccacctgttacagtgcctgaagctcccaaagaagttgtccctgaaaagaaagtgcctgtg
ccacttcctaaagagccagaagtcccacctgttaaagtgcccgagcctcccaagaaagtt
gttcctgaaaagaaagtacctgtggcgcctcctaaagagccagaagtcccacctgttaca
gtgcctgaagctcccaaagaagaaatcatccctgaaaagaaagtgcctgtgccacctcct
aaaaagtcagaagtcccacctgttaaagtgcccgaggctcccaaggaagttgtccctgaa
aagaaagtgcatgtgccacctcctaaaaagccggaagtcccacctgttaaagtgcctgag
gctcccaaggaagttgttcctgaaaagaaagtgcctgcgccacctcctaaaaagccggaa
gtcccacctgttaaagtgcccgaggctcccaaggaagttgttcctgaaaagaaggtacct
gcggcacctcctaaaaagccggaagtcccaccagccaaagtgcccgaggtgccaaaggca
gctgtcccagaaaagaaagtgcctgaagctattcctcccaaacccgaaagtcctccccct
gaagtgtatgaggagcctgaggaagttgttccggaagagcctccagctgaagtggtggaa
gagccagagcccgcccctccccccaaagtgactgtgccacctaagaaacctgtcccagag
aagaaaccacctgctgtcattgccaaaaaacctgaaccaccaccagtgaaagtgcccgag
gtgcccaaggaagttgttcctgaaaagaaagtgcctccagtggttcccaaaaagccagaa
gtcccgcctgctaaagtgcctgaagttccaaaagaagttgttccagaaaagaaagtagct
gttcccaaaaagccggaagtcccaccacccaaagtgccagaggtgccaaaggaacctgtc
gtggaagagaaaccagctgttcctattcccgaagaagtggagccgcctcctccagaagta
tatgaagaacccgaggaaattgctcctgaagaggaagagccagttcctgttgcagaggag
gaaccagaggcgcccccaccagcagtgcctgaagagcccgagaagattgttccagagaag
aaagtgcctgtcatcaaaaaaccagaagctcctcctcctaaagaacctgaacctgaaaag
aaggttgttgagaaaccaaaactcaaaccaaggcccccagctcctgctcctgctccacct
aaggaagacgtgaaggagaaaatagcccaacttaaagctgtttcaaagaagaaagttcct
gaaaaacctgaggttccagaaaaagtggagcttaaacctctgaaagtgcttggaggggaa
aagaaagttcgcaaattacttcctgaacctaaaccgcaaccaaaggaagaagttgttctc
aaaagcgttctaagaaagaaacctgaagaagaagaacctaaagtagaacctaaaaaagta
gaaaaagttaaaaaacctgcagtaccagaaccacctccaaagcctgttgaagaggttgaa
gcacctccagctgctgttacaaaaagggaaaagaaagttcccgaaccaacaaaagtgccc
gaaattaagccaccaatacctctccctgcacctgaaccgaaaccaaagcccgaaccagag
gtgaaaataatcaaaccacctccagtggagcctgcaccaacccccatcgcagccccagtg
accgtgccagtagttggaaagaaagcagaagccaaagcacccaaagaggaggctgccaag
ccgaaaggtcccatcaaaggtgtagccaaaaagactccttcaccaatagaacttgaaaag
aaaaagttgagaccaggaagtggtggggagaaacctcctgatgaagccccgttcacctac
cagctgaaggctgtgccactgaagtttgtgaaagaaatcaaagacatcgtcttgaccgaa
gcagagtcagttggctcttctgcaatttttgaatgtctagtctctccctctactgccatt
acaagctggatgaaagatggtagcaatatccgtgagagccccaaacacagattcatcgca
gatggtaaagacagaaagctgcatatcattgatgttcagctttctgatgctggcgaatac
acctgtgttttacgtttgggaaataaagaaaagacctccacggcaaaacttattgtagaa
gaacttcctgtgcgctttgtgaaaacgcttgaagaagaagtcacagtggtcaaaggacag
ccattgtacttgagctgcgagttaaacaaagagcgcgatgtggtctggaggaaggatggg
aagattgtggtggagaagcctggcaaaattgtgcctggtgtcattggcttgatgcgggcc
ctgactatcaatgatgcagatgacactgacgccggaacgtacacagttactgtggaaaac
gccaacaacctggaatgttcatcttgcgtaaaagtcgtagaagtcattagagactggctg
gtgaaacccatacgagatcagcatgtgaaacccaaggggacagctgttttcacctgtcat
atagcaaaggatactccaaacattaagtggttcaaaggatatgatgaaatcccctgggaa
ccaaatgataagactgagatagtgaaagatggaaatcatctatccctcaaaattaagaat
gccacaccagaagatattgatgaatatgcagtggaaattgaagggaaaagatatcctgca
aagctaacacttggagaccgcgaagttgaattgcttaaaccaatagaggatgttaccatt
tatgagaaagaaagtgcaagctttgatgcagaaatctcagaggcagacattcctggacaa
tggaaactgaagggagaactcctaaggccttcacctacttgtgaaatcaaagcagaaggt
gggaaacgcttcttaactttgcacaaagtcaaactggaccaagctggtgaagtcctttac
caggccctcaatgcaattacgacggccattctgacagtaaaagaaatcgaacttgacttt
gctgtgcccctgaaggatgtcactgttccagaaaagcgacaggctcgatttgaatgtgtc
ctcacccgagaggcaaacgttatatggtctaaagggcctgatatcatcaagtcatctgac
aagtttgatatcattactgatggaaagaaacacattcttgtcatcaataattctcaattt
gatgacgaaggggtctataccgcttcggtggagggcaagacgacctcagcacgattattt
gttacaggtataagattgaagttcatatcgcctcttgaagatcaaacagtgaaagaaggt
gaaacagcaacttttgtttgtgagctttctcatgaaaaaatgcatgtagtctggttcaaa
aatgatgtcaaactccacacgagcagaactgtactcatctcatctgagggcaaaactcac
aaattggaaatgagagaagtgaccctggatgatatatcccagataaaagctcaagtgaag
gacctgagctccacagcaaacctaaaggtcttagaggccgatccctacttcactgtgaaa
ttacatgacaaaactggagtcgagaaggatgagattattctgaagtgtgaagtgagcaaa
gatgtgccagtgaaatggttcaaagatggtgaagagattgaaccttcacccaaatactcc
atcaagtcagacggcctgcgccgcatcttaaaaatcaaaaaggcagaacttaaagataaa
ggcgaatatgtgtgtgactgtggcacagacaagacaacagcaaatgttaatgttgaggct
cgactaataaaagtggaaaaacctctgcgtggagtagaattgtttgttggtgaaacagct
cgctttgaaattgagctttctgaaccagatgttcatggccagtggaagttaaaaggagag
cctttaactgcttcccctgactgtgaaatcattgaagatgggaagaagcatattctggtc
ctttataactgccagctggatatgacaggagaggtctccttccaggctgccaatgctaaa
tctgcagccaaactgaaagtgaaagaattgccacttatcttcatcacacctctcagtgat
gttaaagtctttgagaaagatgaggctaagtttgagtgcgaagtatccagggaacccaaa
acattccgttggctgaaaggaacccaagaaatcacaggtgatgacaaaattgagcttata
aaggatggcactaagcattcaatggtgatcaaatcagctgcttttgaagatgaagcaaaa
tacatctttgaagctgaagataagcacacaagtggcaaactgatcattgaaggaatccgg
ctcaaattcctcaccccactcaaggatgtaacagccaaggagcgggaaagtgccgtgttt
actgtggagctgtcccatgataacatccgcgtcaagtggttcaaaaacgaccagcgcctg
cacaccaccaagttggtctcaatggaagatgaagggaagattcattccatcacattcaaa
aacctctctattgatgacacctctcaaattaaagtagaagctatggggatgagttcagaa
gctaaactcactgtgcttgagggagatccatactttacaggaaagcttcaagattacact
ggcgtagagaaagatgaagtggttctacagtgtgaaattagcaaagcagatgcaccggtg
aagtggtttaaggatggggaggaaataaagccatccaaaaatgctattattaaggcagat
ggcaagaagcgcatgctaatactgaagaaagccttaaagtcagatattggacagtacacc
tgcgactgtgggacagacaagacctcaggaaagcttgacattgaggatcgggaaattaaa
ctggtgcgacccctgtacagtgtggaggtgatggagactgagacggcccgctttgaaacc
gaaatctcggaagatgatatccatgccaactggaaactcaagggagaggcactgctccaa
acacctgactgtgagatcaaggaagaaggcaaaacgcacttcctaattttgcacaactgc
cgcctggaccaggccggtggggtggatttccaagctgccaatgttaaatctagtgcccac
ctccgagtaaaaccacgagtaattggtcttctgaggcccctgaaggatgtcacggtgact
gcaggggaaacagccactttcgactgcgagctctcttatgaggatatcccagtggaatgg
tatctcaaagggaagaaactggagcccagcgataaggtggtcccacgttcggaaggaaga
gttcacacacttactctgagggatgtaaagttagaagatgctggagaagtccaactaaca
gcaaaagatttcaaaactcaagccaaactctttgtgaaagaacccccagttgaattcact
aagcctcttgaggaccagacggtcgaagaggaagccactgcggtattggagtgtgaagta
tccagagaaaatgcaaaggtgaaatggttcaaaaatgggacagaaattctcaaaagcaag
aagtatgaaattgttgctgatggcagggtcagaaaacttattatacatggctgtacccca
gaggatattaaaacatacacttgtgatgctaaggattttaagacttcctgtaacctgaat
gtcgtgcctccgcatgtggaattcttaagaccactcaccgatcttcgagttaaagaaaaa
gaaatggctcgatttgagtgtgaactctcccgagaaaatgccaaggttcactggttcaaa
gatggtgctgaaattaaaaagggcaaaaaatatgatattatatctaagggagctgtgcgc
attctggtcatcaacaaatgtctacttgatgatgaagcagaatattcctgtgaagtaagg
acagcaagaacttctggcatgctgacagtagtggaagaagaagctgtctttaccaaaaat
cttaccaacgttgacgttagtgaaacagacactataaaactggtttgtgaagtctccaag
cctggagcagaagtgacttggtacaaaggggatgaagagatcattgaaacaggaagatat
gaaatacttactgatgggcgaaagagaatcctgatcattcagaacgctcaccttgaggat
actggcaactacaactgccgactcccaagttctcgaactgatggcaaagtcaaagtacat
gaacttgctgctgaatttatctcaaagcctcaaaaccttgaaatacttgaaggagaaaag
gctgaatttgtctgctctatatcaaaggaaagctttgaagtccaatggaagagagacgat
aagacacttgaatctggagataaatatgacgttattgctgatggcaaaaagaggatccta
gttgtgaaagatgccacgttacaagatatgggcacttacgtagtcatggttggggccgcc
agagcagcagctcacttgacagtaattgaaaaactcaggatcatagttcctcttaaggac
acccgtgtgaaggaacaacaagaagtcatcttcaactgtgaagtcaatactgaaggtgcc
aaagccaaatggttcagaaatgatgaagccatatttgatagttcaaaatacattattctc
caaaaagacctggtctacaccctcaggattagagatgcacgattagatgatcaagccaac
tatagtgtgtctctgaccaatcatagaggtgaaaatgttaagagtgcagccaatctaata
gtagaagaggaagaccttaggattgttgagcctcttaaagatattgaaacaatggagaag
aaatctgtcacattctggtgcaaggtgaatcgtctcaatgtaacactaaagtggaccaaa
aatggagaagaggtggcttttgacaaccgtgttttatacagaattgataaatataagcac
tctctaatcattaaagactgtggcttcccagatgagggtgaatacatcgtcactgctgga
caagataaatctgttgctgagcttctcatcatagaagcccctacagaatttgtggaacac
ttggaagaccagacagtcactgagtttgatgatgctgtcttctcctgccagctctccaga
gagaaagcaaatgtaaaatggtacagaaatgggagggaaatcaaagaaggcaaaaaatac
aaatttgaaaaagatggaagtgtacatcgactcattataaaagattgcaggctggatgat
gaatgtgaatatgcttgtggagtggacgacaggaagtctagagctagactttttgtggaa
gaaatccctgttgagatcatcaggcctccccaagatattcttgaagctcctggtactgat
gttgtcttttgggctgagctcaacaaagataaggtggaagtccaatggctaaaaaataac
atgattattgtccagggtgacaaacaccaaatgatgagtgaaggaaagatacacaggcta
cagatttgtgacattaggccacgtgaccagggtgaatacagatttattgctaaagacaaa
gaagccagagctaagcttgaactggcagctgcacctaaaatcaagacagctgatcaagat
cttgtggttgatgttggccagcctctgacaatggtggtgccctatgatgcctaccccaaa
gcagaagctgagtggtttaaagaaaatgaagctctgtcttcaaaaactgttgatactaca
gctgaaaaaacttctttcagaattttagaagccaagaaaggagacaaaggaaggtataaa
attgtgcttcagaacaaacatggaaaagcagaagccttcatcaatttacaagttattgat
gttcctgggccagtacgtaacttagaagtgacagaaacacttgatggtgaagtgagcctc
gcttgggaagaaccattaactgatggtggaagcaaaatcataggttatgttgttgaaaga
cgtgacatcaagagaaagacctgggttctggccactgaccgtgcagacagttgtgagttt
actgtcactggactacaaaaaggaggagttgaatacctattccgtgtgagtgcaagaaac
agagttggcactggtgaaccagtagaaactgccaatcctgtggaagcaaggagtagatat
gacgttccaggccctcctttgaatgtgaccatcacagatgtgaatagatttggtgtctca
ctgacatgggaaccaccagagtatgatggaggggctgagatcacaaattacatcattgaa
ttaagagacaaaacttctatcagatgggacactgccatgacagtaaaagctgaagacttg
tctgcaactgtcactgatgtggtggaaggacaggagtatagtttccgggtcagagcccaa
aaccgaattggagttggaaaaccaagtgcagccacacctttcgtcaaagttgctgatcca
attgagagaccaagtcctcctgtgaacctaagttcctcagatcagactcagtcatcagtt
cagctcacatgggaacctcctctgaaagatggaggaagcccaatattgggctacataatt
gagcgatgtgaagaaggaaaagatgagtggattcgttgcaataagaaacttgtccctgaa
ctgacttacaaggttactggattacaaaaaggaaataaatatttatatcgagtatctgca
gaaaatgaagctggtgtttcagatccatctgaaattcttggtcctctaactgctgatgat
gcatttgctgaaccaacaatggatttaagttcatttaaagatggtctggaagttattgtc
ccgaaccctatcaagatcctggttccaagtacaggctatccaaggccaactgcaacctgg
gcgtttggagataaagtactagaagcaggggaccgtgtgaaaatgaaaaccttatctgcc
tatgctgaactggtcatttctccaagtgaacgtccagacaagggcatttatacactgaaa
ttagaaaatcgtgtgaaagcaatttctggggaaattgatgtcaatgtaattgctcgccca
agtgcacccaaagaactgaaatttgatgacataaccagggactcagtacatttgacttgg
gaaccaccagatgatgatggaggaagtccattaactggatatcttgttgaaaagcgagaa
gtcaaccggaaaacatggactaaagttatagactctgtgactgacctagaattcacagtt
cctgatcttgttcaaggaaaagaatatttatttaaagtctgtgctcgtaacaagtgtggc
cctggagaacctgcatatgttgatgaacctgtaaatatgtcagctcctgcaacggtacct
gacccaccagagaatgttaaatggagagatcgaacagccaagagcatcttcctaacatgg
gatccacctaaatatgatgggggttcacgcatcaaaggatatatagttgaaaaatgtcca
cgtggttctgatcgatgggttgcctgtggggaaccagttgcagaaacaaaaatggaagtg
acaggccttgacgaaggccagtggtattcctaccgtgtgaaggccttgaataggcaaggt
gccagcaaaccaagcaagcccacagatgaaatccaggctgtggacgcacaggaggctcca
gaaattttcctcgacgtgaagctccttgctggtctcactgtaaaggcaggaactaagatt
gaacttcctgccactgtcactggaaaacctgaacctacaataacttggacgaaggctgac
acgcttctgaggcaggacaaaagaatcaccattgaaaatgttcctaaaaaatccaccgtg
actatcgtcgatagcaagagaagtgacactggcagatacattatcgaggctgtgaacgtc
tgtggtcgggccactgccgtggcagaagtgaacgtcttagataaacctggaccaccagct
gcttttgacatcacagaagtgaccaacgagtcatgtcttctaacatggaacccaccacga
gatgatggtggatctaaaatcacaaactatgttgtggagagaagagcagctgacagtgat
atgtggcacaagctctcatcaactgtcaaggatacaaaattcaaggcaaccaacttaatc
cccaataaagaatacctcttcagagttgctgcagaaaacatgtatggtgttggtgaacca
gttcaggccactccaataacagccaaatatcagtttgatccacctggacctccaactcgc
cttgaaccttctgatatcactaaagatgcagtgactctcacatggtgtgagccagatgat
gatggtggcagcccaatcactggatattgggttgaaagattagatcctgatactgataaa
tgggttaggtgcaataagatgccagtaaaggacacaacatacagagtgaaagggctcacc
aataagaaaaagtacagattccgtgtgttggctgaaaatcttgctggacctggaaaacca
agtcgatcaacagaaccgatcttaataaaagatcccatagaccctccatggccccctgga
aaaccaactgtgaaagatataggcaaaacgtcaataatgttgaattggacaaagccagaa
catgatggaggggcaaagattgagtcttacgtcattgaaatgctaaagactggaacagag
gactgggtccgagtggctgaaggggttcccaccactcagcatttgctcccggggctcatg
gaaggtcaggaatactcattccgagttagagctgtgaacaaggccggggaaagtgaaccc
agcgaacccagtgaccctgtgctttgccgggagaagctatatcctccatcaccacctcgc
tggcttgaagttattaatatcacaaaaaatacagcagacctaaagtggacagtccctgag
aaagatggagggtcccccatcaccaactacatcgtggaaaagagagatgtgaggcgaaaa
ggctggcaaacggtggacacgaccgtcaaggacaccaagtgcacagtaaccccactgaca
gagggctccttatatgtgttccgagtcgctgcagaaaatgccataggacaaagcgactac
tgtgaagtcgaggactccgtcctggccaaagacactttcaccacacctggaccaccctat
gctctgacagtggttgatgtgacgaaacgacatgttgacctgaagtgggaaccacctaaa
aatgatggtggaagaccaatacagagatatgtcattgagaagaaagaaaagttaggcacc
cgttgggtgaaagctggaaagacctcaggacccgactgtaacttcagagtaactgatgtc
attgaaggaacagaggtccagtttcaggttcgggcagaaaatgaagctggagttggtcat
ccaagtgaacccacggaaatcctgtcaattgaagatccaacaagtcctccttcacctccc
cttgacctgcatgtgactgatgctgggagaaagcacattgccattgcttggaagcctcca
gagaaaaatggtggaagccctattataggataccatgttgaaatgtgtccagtaggcact
gaaaaatggatgcgagttaattctcgcccaataaaagacttgaaattcaaggttgaagaa
ggcgttgttcctgacaaggaatatgttctgagagtgagagctgtcaatgctgttggtgtc
agtgagccatctgaaatctccgaaaatgtggttgccaaagacccagattgcaagccaaca
attgatctggagactcacgacattgttgttattgaaggtgaaaagttaagcattcctgtt
cccttcagagctgtcccagttccaaccgttagttggcataaagatggcaaagaagttaaa
gcaagtgatagattaacaatgaagagcgatcacatctctgcacacctcgaagttcccaag
agtgtccatgcagatgctggagtttacaccattacactggagaataagcttggctcagca
actggctcaatcaatgtcaaagtcataggcctacctggaccatgcaaagatattaaagca
agcgacgtgaccaagagttcttgtaaattaacctgggaacctccagaatatgatggtgga
agcccaattcttcattatgtcctggaacgcagagaagctgggaggaggacatatatacca
gtcatgtctggtgagaacaaactgtcctggactgtaaaagatctcataccaaatggtgaa
tacttcttccgtgttaaggctgtcaacaagattggtggaggcgaatatattgaactgaaa
aatccagtcattgctcaagatccaaagcagccccctgatccacctgtagatgttgaggtt
cataatcctacagcagaggcaatgactattacatggaagccacctttgtatgatggaggg
agcaagataatgggttacatcatagagaagattgctaagggtgaagagagatggaagaga
tgtaatgaacacctggtacccgtcctgacctatacagcaaaaggactcgaagagggaaag
gaataccagttccgtgtgcgagcagaaaatgctgccggtatcagtgaaccttctcgggcc
actcctccaaccaaagctgtagatcctattgatgccccaaaagtcattctgagatcaagc
ctagaagtgagacgaggtgatgaaatagcactcgatgcaactatttctgggtcaccttac
ccaactattacatggataaaggatgaagaaattattacaccagaggaaattaagaagcga
gtagcacccatggttaggaggaggaggggtgaagttcaagaagaagaaccatttgtcctg
tctctgacggagcgtttgagcattgacaatagtaaaaaaggagaatctcaactacgcgtc
cgagattctattcgacctgaccatggccaatatatgatcaaagctgaaaatgaccatggt
attgcaaaagctccttgcactgtcagtgtgctagatacaccaggaccaccgatcaacttc
gtatttgaagatgttagaaagaactcagtcgtctgtaaatgggaaccaccccttgatgat
ggtggcagtgaaattataaactacactttggaaaagaaagacaagacaaaacctgactcc
gaatggattgttgtcacttcaacacttagacattgcaaatatccagtgacaaagctgatt
gaaggaaaagagtacctcttccgtgtaagagcggaaaataggtttggacctggaccacca
tgtgtttcaaagccacttatagctaaagatccatttgaaccacctgatgcacccgataag
cctattgtggaagatgttaccagcaacagtatgctagtgacatggaatgaaccaaaagat
aatggaagccccatcttaggttactggcttgaaaaacgtgaggttaatagtacacattgg
tcccgtgtcaacagaaacctcctcaattctttgaagaccaatgtagaaggcctattagag
ggactcacctatgtcttcagagtatgtgctgaaaacgcagctggacctggaaagttcagt
cccccttcagatcccaaaacagcacgtgatccaatcgctccacctgggccacctgtccca
agagtcgctgacacaagctctacaaccattgaactcgaatgggaacccccagctttcaat
ggtggtggggaaattattggttactttgtcgataagcagctggttggcacaaatgaatgg
tcacgctgcacagagaagatgatcaaggcccgtcagtacacggtcagagaaatccgagag
ggtgctgattacaaacttcgagtgagtgctgtcaatgctgcaggtgaaggaccacctgga
gagacagaacctgttactgtggctgaaccaaaagagcctcccactgtggaactagatgtt
tctgtcaaggctggaatacaaataatggctgggaagactcttagaattccagctgtggta
actggtcgtccagtgcctacaaaagtatggacaatagaagaaggggagctggataaagac
cgtgttgtaatagagaatgttggaaccaaatctgaactaattatcaagaatgcattgaga
aaagatcatggcagatatgtgattacagctaccaatagctgtggttccaaatttgcagcc
accagggtagaagtttttgatgtccctggtccagttcttgacttaaaacctgttgtaaca
aacagaaagatgtgtctgcttaactggtctgatccagaagatgatggaggaagtgacatc
acgggctttattattgaaagaaaagatgctaagatgcatacttggagacaaccaatagag
actgacagatctaaatgtgacatcacaggtctccttgagggacaagaatatatgttccgt
gtgattgccaagaacaagtttggctgtggccctcctgttgaaataggaccaattcttgca
gttgatccactaggtcctccaacgtctcctgagaggctcacatatacagaaaggacgaag
tccactatcaccctggactggaaagagccccgtaacaatggtggcagccccatccaaggc
tacatcattgaaaaacggcgtcacgataaacctgactttgaaagagttaacacgcgactc
tgcccaaccacgtcttttctggttgaaaatcttgacgaacaccaaatgtatgaattccgt
gtcaaagccgtcaatgaaattggtgaaagtgaaccatccttgcctcttaatgtggtcata
caagatgatgaagtgcctccaactattaagttgcgcctggctgttcgaggagacactatc
aaagttaaggcaggagagcctgttaacatccccgcagatgtgacaggccttccaatgcct
aagattgagtggtccaagaatgaaactgtgattgaaaaacccactgacgcacttaagata
acaaaggaagaagtatcccgaagtgaggcaaagactgagcttagcattcccaaagcagtc
cgggcagacaaaggcacttacacagttactgcttccaatcgccttggctcagtgttccga
aatgttcacgttgaagtatatgatcgtccatccccaccaagaaatcttgctgttactgac
attaaagctgaatcttgctacttgacttgggatgctcctctagacaatggtggcagtgaa
attacccattatgtcattgacaaacgtgatgcaagtaggaagaagagtgaatgggaggaa
gtcaccaacactgctgtagagaagagatatgggatctggaaacttatccccaatggtcag
tatgagttccgagtaagggcagtgaataaatatggaatcagtgatgactgcaaatcagat
aaggtggtcattcaagatccttatcgcccacctggacctccgggaaaaccaaaagtcttg
gagcgcaccaaagggtcgatgctagtgagctggactcctcctttggacaatggcggctct
ccaattactggctactggctggagaagagagaagagggaggtgcctactggtcacgtgtt
agccgagcaccaataactaaaacgggattgaaaggcgtggaatttaatgttcctcgtttg
attgaaggcgttaaataccagttcagagcaatggcaataaacgctgcaggagttggccct
cccagtgaaccatcagatccggctgttgcaggagatcctatatacccacctgggccacct
tcttgcccagaggtcaaagataaaacaaagtcaagcatctcgctagcatggaaacctcca
gccaaagatggtggcagtcccatcaaaggatacattgtagaaatgcaagaggaaggtact
actgactggaaaaaagtaaatgaaccagacaaacttctaactacctgtgaatgtgtggtg
ccgaatttgaaagaactcaggaagtacagattcagagtaaaagctgtcaatgaagctggt
gaatctgaaccaagtgatacaactggagagatccctgccactgatattctagaggtacca
gaagttttcattgacattggagcacaggactgtctgatttgtaaagctggctcacagatt
aggattcctgctgtcatcaagggacgcccaacaccaaaatcatcttgggaatttgatgga
aaggcaaagaaggcattgaaggatggagttcatgacatacctgaagatgcacagctggag
actgctgaaaactcatcagtaattattattccggagtgtaaacgatctcattcaggcaaa
tacagcatcacagccaagaataaagcaggacaaaagactgcaaattgcagagttaaagtc
atggatgtaccaggcccacccaaagatctgaaagtcagtgacatcacaaggggtagttgc
agactttcatggaagatgccagatgacgatggaggagacaggatcaagggttatgttatt
gagaagaagactattgatggaaaagcctggactaaagtcaatccaaactgtggaagcacc
acatttgtgattcctgatctcatctctgaacagcagtatttcttccgcgtgcgtgcagaa
aaccgttttggtattggtgcacctgtggaaaccattcagaggaccactgccagagatcca
atatatcctcctgatccccctattaaactcaagattggcctcataacaaagaacacagta
cacctgtcatggaaacccccaaagaatgatgggggctcccctgtcacccactatattgtt
gagtgtcttgcatgggaccctactgggaaaaagaaagaagcatggaaacagtgcaataag
cgtgatgtggaagaactggaatttaccgtggaagacctcgtggagggaggggaatatgaa
ttcagagtcaaagctgtcaacgctgccggagtcagcaaaccttcagaaactgtgggccct
gtgattgtcaaagatcagacatgcccaccatcaattgagctcaaagaatttatggaggtt
gaagaaggaactgatgtcaacatagtggccaaaattaaaggtgtgccattcccaacacta
acctggtttaaagcgcctccaaagaagcctgataacaaagaacctgttgtctatgacacc
cacgtcaacaaagtggtggtggatgatacttgcaccttagttattccacagtctcgccgg
agtgacactggcttatatactatcacagccgtgaataacctgggaacagcatcaaaggag
atgagactgaatgtccttggtcgtcccggccctccagtgggacccataaagtttgaatct
atttcagcagatcaaatgacaatatcttggcttccacctaaagatgacggtgggtctaag
attacaaactatgtaattgagaaaagagaacctaacaggaagacctgggtgcacgtcacc
agtgaacctacagagtgcatgtacacaattcccaaattgcttgaaggccatgaatatgta
ttccgaatcatggcccagaataaatatggcattggcgagcctcttgacagtgaacctgaa
acagcaagaaacctcttttctgtccctggagcaccagataaaccaacagttagcagcgtg
actcgtaattccatgactgtcaactgggaagagccagaatatgatggaggctctcctgtg
acaggatactggctagaaatgaaagataccacttcaaagagatggaagagagttaatcga
gatcctattaaagccatgactttgggtgtttcttataaagtgactggtcttatcgaaggt
tctgattatcaattccgggtatacgcgatcaatgctgctggggtgggtccagcaagtctg
ccatcagacccagtaactgctagagatccaattgcccctcctggtcctccatttcccaag
gtcacagactggactaaatcaactgcggatttggagtggtctcctccactaaaagatggt
ggatccagagtaactggatacattgttgaatataaagaagaaggaaaagaagaatgggaa
aaggctaaagataaagaagtgagaggaacaaaacttgttgtgacaggattaaaagaagga
gcattctacaaatttagagttagagcagtcaacattgccggcattggagaacctggagaa
gttacagatgccattgaaatgaaggacagacttgtgttacctgacgttcagctggatgcc
agcgtcagagacagaattgtggtccatgctggaggagtgatccggatcatcgcctatgtg
tctggaaagcctcctccaacgatcacatggaacatgaatgaaagagccttacctcaagaa
gccaacattgagaccacagccattagctcatccatggtcatcaagaattgccagaggagc
caccaaggcgtctattctcttcttgccaaaaatgcggcaggagaaagaaagaagaccatt
atcgttgacgtattagatgtgccaggtcctgttggaataccattcctgcctcacaaccta
accaacgactcctgcaaactgacatggttttctccagaagatgatggaggctctccaatc
accaattacgtcattgaaaagcgggaagctgaccgcaaagcatggacaccagtgacatgt
acagttacccgacaaaatgctaccgtccagggtctcattcaaggaaaagcctactttttc
cgaattgcagctgaaaatagcattggcatgggcccatttgttgagacaacagaggaactt
gtcatcagagatccaataactgtaccagagcgtcctgaagacctggaagtcaaagaagtt
actaaagattctgttactttgacttggaatcctcctaagtatgatggcggatcagaaatt
attaactatgtcctagaaagccgtctcattggaactgagaagttccacaaagttacaagt
gacaacttgcttagcagaaagtacactgttaaaggcttaaaagaaggtgatacctatgag
taccgtgtcagtgccgtcaatattgttggacaaggcaaaccatccttttgcaccaagcca
atcacttgcaaggatgagctggctcctccaacccttgaccttgacttcagagataagctc
acaattcgagttggtgaagcttttgccctcactggccgttactcaggcaaaccaaagcct
aaggttacttggttcaaagatgaagctgacgtgctagaagatgaccgcactcaaataaag
accactccaacaacacttgctctagagaagatcaaggccaaacgttctgattccggcaaa
tactgtgtggttgtggagaacagtacaggctctaggaaaggtttctgtcaagttaatgtt
gttgatcgtcctggaccaccagtaggaccggttatttttgatgaggtaaccaaagatcac
atgattatctcttggaagccacctttagatgatggaggcagtgaaattaccaattatatt
attgagaagaaggaggtgggcaaagacgtttggatgccggtgacatctgcatgtgctaaa
acaacatgcaaagttcctaaactgcttgaaggaaaagattatattttccgtatacacgcc
gaaaatttgtatggaataagtgatcctctggtgtctgattcaatgaaagccaaagatcgt
ttcagggttcctgatgcacccgaccagccaattgttacagaagttaccaaagactctgca
ttagttacatggaacaagccaaatgatggaggaaagcccatcacaaactacatcctggaa
aagagggaaactatgactaaacgatgggttcgagttaccaaagagcctatccacccatac
actaaatttagggttcctgaccttctagaagggtgttactatgaattccgagtttctgca
gaaaatgaaattggtattggagacccaagcccaccatccaaaccagtctgtgctaaagat
ccaattgctaaaccaagcccacctgttaatcctgaagcaatagatacaacatgtaattca
gttgatctaacttggcagccaccacgtcatgatggtgggagcaagattctgggttatatt
gttgagtaccagaaagttggagatgaagagtggaaaagagccaatcacactcctgagtca
tgtcctgaaactaaatataaagtcactggtctccgggatggtcaaagctataagttcaga
attagagcagtcaatgaagctggtgaatcggacccagctcatgttccggagccagtgcta
gtaaaagacagacttgaaccccctgagttgattcttgatgccaacatggcaagagaacaa
cacataagggttggtgatactctaagacttagtgccgtcatcaaaggagtgccattccca
aaagtaacttggaaaaaagaagacagagaggctccaactaaagcaagaattgatgttact
ccagttggtagcaagcttgaaattcgtaatgctgcccatgaagatggtggaatttattcc
ttaacagtggagaatccagctggttcaaaaactgtctcagtaaaagtacttgtattagat
aagcctggaccacctagagatctggaagtcagtgaaatcagaaaagattcttgctacctc
acttggaaggaaccattggatgatggtggttctgttgttacaaattatgtggttgagagg
agagatgttgccagcgcccagtggtcacctctttcaactacatcaaagaaaaagagtcac
ttggctaagcatcttaatgaaggcagtcagtatctcttccgagtagctgctgagaaccag
tatggacgtggtccttttgttgaaacacctaaacccatcaaggctgtggatcccctacat
cccccagggccaccgaagaacctacaccacgtagacgttgacaagaatgaagtctccctt
gtttggaataagccagatcgtgatggtggttctccaatcactggatatttggtggaatat
caagaagagggcaccgaagattggattaagttcaagactgtgacaaacttagagtgtgtt
gttactggactacaacaaggaaaaacctataaattccgtgtaaaagctgaaaatattgtg
ggtcttagtctccctgatacaactatcccaatagaatgtcaagaaaaactagtgcctcca
tctgtggaactggatgtgaaattaattgaaggccttgtggtaaaagctggaactacagtc
agattccctgccattataaggggtgtacctgttcctactgcaaagtggacaaccgatggg
agtgagattaaaacagatgatcactacacagttgaaactgacagctactcatcagtgctt
accattaagaactgcttaaggaaagacactggggaatatcaaatcacagtttccaatgca
gctggcagcaaaacagtagccgtccatcttactgttcttgatgttcctggtccaccaaca
ggtcctattaatattctggaagttacccctgaacatatgactatctcatggcagccacct
aaggatgatggaggaagccctgtgataaattatatcgttgagaaaaaagatacaaggaaa
gacacgtggggtgttgtctcttcaggaagcagtaagacaaagctgaaagtcccacatcta
caaaagggttttgaatatgtcttccgagttagagcagagaataagatgggtgttggtcct
ccccttgactccgtacctactgttgctaaacacaagtttagtcctccatctcctcctggt
aaaccagtggttactgacataactgaaaatgctgcaacagtgtcttggactctgcctaaa
tctgatggtggcagtcctataactggttactatgtggaacgtcgagaaataactggcaaa
tgggtgagggtcaacaaaacacctataactgagctgaagtatacagtgactggactctat
gacggaaatacatatgagtttagagtttttgctgaaaatcttgcagggctaagcagtcca
tccccaagttctgacccaataaaagcttgccgacccatcaaaccacctggaccacctatt
aatcctaaactgaaagacaagaccagagaaacagctgacttggtgtggacaaagcctctc
agtgacggtggtagccccattctaggctatgtagtggaatgtcagaaacctggtacagca
caatggaacaggattaataaagatgaactcattaggcaatgtgcctttagggtacctggt
ctaattgaaggaaatgaatacagattccgtataaaggcagctaatattgtgggggaggga
gagccaagagaactagcagaatctgtgattgcaaaagacatccttcatcctccagaagta
gaacttgatgttacttgtcgtgatgttattactgttagagtgggccaaactatccgcatt
cttgctcgagtcaaaggcagacctgaaccagacataacttggtccaaggaaggcaaagca
ttggtccgagaaaagcgagttgacataattcacgatctacctcgcgctgagttacaaatt
aaagaagctattagagctgatcatggcaagtatatcatctcagctaagaacagcagtgga
catgcccaaggttccactatcgttaatgtccttgacagacccgggccttgccagaattta
agggttagcaatgtaactaaagagaactgtacgattgcttgggaaaacccactagataat
ggtggctcagaaataacaaatttcatagtagaataccgcaaacccaacgagaaaggctgg
tcaattgttgcttcagatgtcactaagcgattaatcaaggccaaccttttagccaacaat
gaatactatttccgagtttgtgcagagaataaagtaggtgttgggccaaccattgaaaca
aaaactccaattctggctattaaccctattgatagaccaggtgagcctgaaaaccttcat
attgcagacaaaggaaagacatttgtctatctaaagtggcggcggcctgactatgacggt
ggtagcccaaatctatcatatcatgttgagaggaggctgaagggctctgcagactgggaa
agagtgcacaaaggcagcattaaagaaacccactacatggttgacaagtgtgttgaaaac
cagatttatgagtttagagtgcaaacaaagaatgaaggtggggaaagtgactgggtaaag
acagaggaagttgttgtgaaggaagacttacagaaaccagtacttgagctgaaattaagt
ggtgtgctaactgtcaaagcaggggacaccattagacttgaggcaggtgttagaggcaaa
ccatttccagaagttttatggaccaaggataaagatgctacggacttaacaagatcaccg
agggtcaagattgataccagtgctgattcatctagattttctcttaccaaagcaaagcga
agtgatggtggtaaatatgtaattacagcaactaacacagctggcagttttgtggcctat
gccactgtcaatgttctagataagcctggtcctgtaagaaatctgaaaattactgatgtg
tccagtgataggtgtactatttgctgggatccaccagaagatgacggcggctgtgaaatc
caaaattatattctagaaaaatgtgagagtaagcgaatggtttggtctacctattctgct
actgtcttaacaactggtgctacggtaacacgcctcatagaaggaaatgaatacattttc
agagtccgtgcagaaaataaaataggcacagggcctccaacggaaagtaaaccggtcatt
gcaaaaaccaaatatgatagacctggtcgccctgatcccccagaagtcactaaagtaagc
aaagaagagatgactgtggtttggactccacctgaatatgatggtgggaagtccatcaca
ggatactttttggagaaaaaggaaaaacatggaacacgatgggtccctgttaacaagagt
gcaatccccgagagacgtctgaaagtacagaatctcctcccaggacatgaatatcagttc
cgtgtcaaggcagaaaatgaaattggaattggagaaccaagcttgccatcaaaaccagta
gtggcaaaagaccccatagaaccacctggtccaccaaccaatctcaaagtggttgatacg
accaaaagttctataacccttgcatggggaaaaccggtgtatgatggtggcgcgccgata
attggatatgttgtggaaatgagaccaaaaagaccagatatgtcacctgatgaaggctgg
aaaagatgtaatgcggcagcacagcttgttcgcatggaattcactgtcaccagcttggat
gaaaaccaggaatacgagttcagggtgtgtgcccaaaaccaggttggcattgggcgccct
gcagaactaaaggatgctattaaacctaaagaaatcctagaacctccggagattgatttg
gatgccagcatgagaaaactggtcacagtgagagcaggatgccctattcgactatttgcc
ataataagagggcgaccagcccctaaagtcacttggcgaaaagtgggtatcgataatgtc
gtcagaaaaggacaagtcgatctggttgacactatggccttccttgtcatccccaattct
acccgtgatgactcaggaaaatattccttgacgcttgtaaacccggcaggagaaaaggca
gtgtttgtgaacgtcagagtattagatactcctggacctgtgtctgatttaaaagtttca
gatgtcactaaaacatcatgccacatttcctggggccctcctgagaacgatggtgggagc
caagtgacacattatattgtggagaaacgtgaggccgacagaaagacatggtcaactgtt
accccggaagttaagaaaacaagcttccaagtcaccaatcttgtccctgggaatgagtat
ttcttcagagtaactgctgtcaatgagtatggccctggtgtcccaacagacgtccccaaa
ccagtgcttgcatctgatccgctctgtgagccggatcccccaaggaaactagaagtgact
gaaatgacaaagaacagcgctgcattagcctggttaccacccttgcgtgatggaggcgct
aagatcgatggctatatcattagttacagagaagaagagcagcctgcagatcgctggacg
gagtactcagtggtgaaagacctcagccttgttgtcactggcctaaaggaaggaaagaaa
tataaatttagagtagtggccagaaatgctgttggagtcagtttgccaagagaaactgaa
ggagtgtacgaagcgaaagaacagctgttgccaccaaagatccttatgccagagcaaatt
actatcaaagctgggaagaaactccgaattgaagcccatgtgtatggaaagcctcatccg
acctgtaaatggaaaaaaggagaagatgaagttgtcacatccagccacttggcagtgcat
aaagcagacaattcttcaattctgatcataaaagatgttactaggaaagacagtggttac
tatagcctcacagcagagaacagttctggaacagacactcagaaaatcaaagtcattgtc
atggatgctcccgggcctcctcagcctccatttgacatttctgatatagacgccgatgct
tgcaccctgtcgtggcacatccctctggaggatggaggcagtagcatcaccaattacata
gtggagaagtgtgacgtgagccgaggtgattgggtgacagctctagcttcagtgacaaaa
acttcctgcagagttggaaaactgatccccgggcaggagtacatcttccgagtccgtgct
gaaaatcgattcggcatttcagagcctctcacatctccaaagatgctggctaagttccca
tttggtgttcctagtgaaccaaagaatgcacgagtcactaaagtcaacaaagactgcata
tttgtggcatgggacagaccagacagtgatggagggagccccattaccggttacctgatt
gaacgcaaagaaagaaacagtttgctctgggtgaaagctaatgatactcctgtccggtca
actgaatatccttgtgcaggccttgtagaaggtcttgagtattcattcagaatatatgcc
ctaaacaaagctggatccagcccacctagcaaaccaacagaatacgtaactgcaagaatg
ccggttgatcctcctggaaagcctgaagttattgatgttaccaagaatacggtatccctt
atctgggctcgtccgaagcatgatggaggcagcaaaattattggctatttcgtagaagct
tgcaagcttcctggtgataagtgggtacggtgcaatactacacctcaccagattccccag
gaagagtacacagttactggcttagaagagaatgctcagtatcaatttagagcaattgcc
aagactgcagtaaacattagccagccttcggaaccttctgatccagtgaccatcgtcgca
gaaaatgttcctcccagaatagacctgagtgtggctatgaaatctttgcttactgtaaaa
gctggaactaatgtttgcctggatgctactgtttttggtaaaccaatgccaacagtctcc
tggaagaaggaaggcacactgctacaaccagcagaaggcataaagatggccatgaagcga
aacctgtgcaccctggagctgttcagtgtgaacagaaaggactcaggagactataccatt
actgctgaaaattcaagtggttccaaatcagccaccattaagcttaaagtgttagataaa
ccaggtcctccagcatctgttaaaatcaacaaaatgtattcagatcgtgcaatgctttct
tgggaaccacctcttgaagacggaggctcagaaatcaccaactatattgttgacaaacgt
gaaacaagcagacccaactgggcacaagtctctgctactgtgcccatcaccagctgcagc
gtggagaaactcatagagggccatgagtatcagttccgaatttgtgctgaaaataaatat
ggagtgggcgacccgatcttcactgaaccagcagttgctaaaaacccatatgacccacct
ggacgctgtgatcctcctgttattagcaacatcaccaaagatcatatgacagtaagctgg
aaaccgccagcagatgatggcggctcacccatcactggctatttggtggaaaagcgggaa
acccaggcagtaaactggactaaggtcaacagaaagcctgttatagaaagaacaataaaa
gcaacaggtctccaagaaggcaccgaatacgagttccgagttacagcaataaataaggct
ggaccaggcaaacccagcgatgcatccaaagctgtttatgcccaggaccctctctatcct
cctggcccaccagcttttcctaaagtatatgatacaacacgtagctccgtgagtctatct
tggggcaagccagcctatgacggtggtagccctatcattggttaccttgttgaagtaaaa
cgagctgactctgataactgggtgaggtgcaatttaccacagaagctacagaagacccgc
tttgaggttaccggcctgctggaaaacacagagtatcaattccgcgtgtatgccgtcaat
aaggttggatacagtgaccccagtgatgtgccagacaaacattgtcccaaggacatctta
attccacctgagggagaacttgatgccgatttgaggaaaacactcatattacgtgctgga
gttacaatgagactgtatgtaccagtaaaaggacgtccacctccaaagataacttggtct
aaaccaaatgtcaatctaagagaaaggattggactggacataaagtcaactgactttgac
actttcttgcgctgtgaaaatgtaaacaaatatgatgcaggaaaatatatcttgactctg
gagaacagctgtggtaaaaaggagtataccatcgtagtgaaagtgctcgatactcctggg
ccacccgtcaatgtgactgttaaggaaatatccaaagattctgcttatattacctgggat
cctcccattattgatggtggaagccctatcataaattatgtggtagaaaaacgtgatgca
gagaggaagtcctggtctacagtgacaactgagtgctcaaaaacaagcttcagagtatcg
aacttggaggagggaaaatcctacttcttcagggtgtttgctgaaaacgagtatggcatt
ggtgatcccggtgaaacacgtgatgccgtcaaagcttctgaaacccctggaccagttgtg
gacctgaaagtgacgtctgtaactaagtcatcttgtagcataggctggaaaaagcctcgc
agtgatggtggaagtcgaataattggatatgtggttgatttcttgaccgaagaaaataag
tggcaacgagttatgaaatcagcaagcttacagtactccacaaaagatttgactgaaggg
aaggaatataccttcagagtgagtgctgagaatgaaaatggagaaggaaccccaagtgaa
atcactgctgtggcaaaggatgatgttgtggctcctgaccttgacttaaaggatctacct
gatttgtgctacttggctaaagaaaacagcaacttccgtcttaagatccccataaaaggc
aagccagctccatcagtatcctggaagaaaggagaagatcctctagcaactgacacaaga
gtcagtgttgagtcatctgcagtcaacacaactcttgtagtatatgattgccaaaaatct
gatgctggaaaatacacaatcacactgaaaaatgttgctggcaccaaggaaggaactctc
tctataaaagttgttggcaagcctggcatccccactgggccaatcaaatttgaggaagtc
acagcagaagccataaccttaaagtggggtcctccaaaggacgatggaggttctgaaatc
accaactatatcctagagaagagagattctgtaaacaacaagtgggtgacctgtgcctca
gctgtccagaaaaccacatttagagtaaccagacttcacgagggtatggaatacaccttc
agggtcagtgccgaaaataaatacggtgtaggagagggcctgaaatcggagccaattgtt
gctaaacatccattcgatgtgcctgatgctcccccacctcccaatattgtggatgtcaga
catgattcagtatctctaacttggactgaccccaggaaaaccggtggctctccaattaca
gggtatcatattgagttcaaggaaagaaacagcctcttgtggaagagagctaacaagact
cctattaggatgaaagacttcaaagtgacaggattaactgaaggccttgaatatgaattc
cgagtcatggctatcaatttagcaggagtaggaaagccaagcctgccatcagagccagtt
gtggcacttgatccaattgatcctcctggcaaacctgaggttattaatgtaacaaggaat
tcagtgactctcatttggactgaacccaaatatgatggtggtcataaattgactggctat
atagtggagaagcgggatctaccctctaaatcttggacgaaagccaatcatgttaatgtc
ccagattgtgcctttactgtaactgaccttgttgagggtggaaaatatgaattcagaatt
agagcaaaaaatacagcaggtgccatcagtgctccatcagagagtacaggaaccattatt
tgcaaggatgaatatgaggcgccaaccattgtccttgatcccacaataaaagatggacta
acaattaaagcaggagataccattattttgagtgccattagcattcttggcaagcccctt
ccaaagtcaagttggtccagggcaggaaaagacattagaccatcagatatcgttcagata
tcttcgactccaacatcttccatgcttactgtcaagtatgccactagaaaagatgctggt
gaatacaccatcactgctaccaatccttttggcacaaaggaggaacatgtgaaggtaata
gtccttgatgtacctggtcctccaggtcccattgaaatcagtaatgtttctgctgaaaaa
gcaacacttacatggacacctcctttggaagacggtggctcaccaattaagtcctatatt
cttgaaaagagagaaaccagccgacttttgtggacagtcgttgctgaagatattcagtct
tgcaggcatgtggcaaccaaacttatccaaggaaatgagtacatcttccgggtctcagct
gtaaaccaatatggcaaaggagaacctgtgcagtccgaacctgtcaaaatggtagacaga
tttggtccccctggccctcctggaaaaccagagatttcaaatgtcactaaaaacaccgcc
actgtcagttggaaaagaccaactgatgatggtggcagtgagatcacgggatatcatgta
gaaaggagagaaaagaaaagtttgcgatgggtgagagcaaccaagacaccagtttctgat
ctcagatgcaaagtaacaggactgcaagaaggaaacacctacgaattccgtgtcagtgca
gaaaacaaagcaggagttggtccacctagtgatgcttcaaatcctgttctaatgaaagat
gtagcatatcccccaggaccaccttcgaatgcacgtgtcactgatactaccaagaaatct
gcttctttggcatggggcaagcctcattatgatggtggacttgaaatcactggctacgtc
gtggagcatcaaaaagtaggagatgaggcctggataaaagatacaacaggaactgccctc
agaatcactgagtttgttgtccctgatcttcagactaaagaaaaatacaattttagaatc
agtgccatcaatgacgcaggtgttggggagccagcagtgattccagatgttgaaattgta
gaacgagaaatggctcctgatttcgaactagatgctgagcttcgaagaacacttgttgtt
cgagcaggactcagtattagaatatttgtgccaattaaaggtcgtcctgctcctgaagtg
acatggaccaaagatgacatcaaccttaaaaacagagctaacattgaaaatacagaatca
tttactcttctgattatcccagaatgtaacagatatgacactggtaaatttgtgatgacc
atcgaaaaccctgctgggaagaaaagtggcttcgttaacgtcagagtcttggatacacca
ggaccagtccttaacctgaagcctactgacatcacaaaggacagtgtcaccctccactgg
gacctccctctgatagatgggggctcacgtataacaaactatattgtggagaaacgagaa
gcaacacggaaatcttactccacagtcaccactaagtgccataaatgcacatataaagtt
accggcttgtctgaaggatgtgaatacttcttcagagtgatggcagaaaatgaatatgga
atcggcgagccaacagaaacaacagaacctgtaaaagcctctgaagcaccatcaccacca
gacagtcttaacattatggacataactaagagcacagtgagcctggcgtggcctaaacca
aaacatgatggtggcagtaggatcactggctacgtgattgaagcccagagaaaaggctct
gaccagtggacccacatcacaaccgtgaagggattggaatgtgtcgtgaggaatctaact
gaaggggaagaatataccttccaagtgatggcagtgaacagcgcagggagaagtgcccct
agagaaagcagacctgtcattgtcaaggagcagacaatgcttccagaactggacctccgt
ggcatttatcagaaattagtcattgccaaagctggtgacaacatcaaagttgaaattcca
gtgcttggtcgaccaaagcccacagttacgtggaaaaaaggagaccaaatacttaaacag
acacagagagttaattttgaaaacacagcaacctcaaccatcttaaatatcaacgagtgt
gtgagaagtgacagcgggccctatcctttaacagcaaagaacattgtaggagaggttggt
gatgtcatcaccattcaagtccatgatatcccagggccacctactggaccaatcaaattc
gatgaagtttcatctgattttgtaaccttctcttgggacccacctgagaatgacggaggt
gtaccaataagcaactatgtagtagaaatgcgacagactgacagtactacatgggtcgag
ttagcaaccaccgttatacgcactacctataaagccactcgtcttactaccggaatggag
tatcaattccgggttaaagctcaaaacagatacggagttggaccaggcatcacatcagca
tctatagttgctaattatccgtttaaggttcctgggcctccaggtacccctcaggtaact
gcagttaccaaagattcaataacaattagctggcatgagcctctttctgatggtggaagc
cccattttaggatatcacattgaaagaaaagaacgaaatggtattctctgggagactgtg
agcaaagcattagtaccaggcaacattttcaaatcaagtggacttacagatggtattgct
tatgaattccgagtgattgcagaaaacatggcaggcaaaagcaagccaagcaagccatct
gaacctgcatttgctttggatcccattgacccacctgggaaaccagttcctctaaatatt
actagacacacagtgacacttaaatgggctaagcctgaatatactggaggctttaaaatt
accagttatatagttgaaaagagagatcttcctaacggacggtggctaaaggccaacttc
agcaacattttggagaacgaatttacagtcagtggcctaacagaagatgctgcatatgaa
ttccgtgtgattgccaaaaatgctgctggggctattagtccaccatctgagccatcagat
gctatcacatgcagggatgacattgaagcaccaaggataatggtggacgttaaatttaag
gacacagttatattaaaagcaggcgaagcatttaagctggaagctgatgtttcaggtcgc
ccacctccaacaatgacatggaccaaagatggaaaagagcttgaaggcacagcaaaatta
gaaattaaaattgcagatttctctactaatctggtaaacaaggattcatcaagaagggat
ggtggtgcctatacccttactgcgactaatcctggtggttttgctaaacatattttcaat
gtcaaagttcttgatagaccaggcccacctgaaggacctttagctgtatctgaagtaacg
tcagaaaaatgtgtgttgtcatggttgcctccactagatgatggaggtgccaaaattgag
cattatgtagttcagaaacgtgaaactagcagattggcatggacaaatgtagcctcagaa
gttcaagtaacaaaactaaaggtcactaaactcttgaaaggtaatgaatacatattccgt
gtcatggctgtaaataaatatggagttggagagccactggaatcagagcctgtgcttgca
gtagatccttttggacgccctgatccacccaaaaaccctgaagttacagctattactaaa
gattcaatggttgtctgctggggacatcctgactctgatggcggaagtgaaatcatcaat
tatatcgtggaacggcgtgataaggccgggcaacgctgggtgaaatgcaacaaaagaact
cttaccgatttaagatataaagtgtctggactgacagagggacatgaatatgagttcagg
attatggctgaaaacgctgctggaattagtgcaccaagtcctaccagtccgttttataaa
gcttgtgatactgtgtataaacctggcccaccaggtaacccacgtgttctggatacaagc
agatcatccatttcaattgcttggaataaacctatctatgatggtggctccgaaatcact
gggtacatggtcgagattgccctgccagaggaagatgaatggaagattgtcactccacca
gctgggctcaaggcaacttcttacaccatcaccaacctcacagagaatcaggaatataaa
atccgcatctatgccatgaattctgaaggaattggggaacctgcacttgttcctggaact
cccaaggctgaagagaggatgctgcctccagagattgaactggatgctgacctgcgcaaa
gttgttactataagagcttgctgtaccctgagactttttgttccaatcaaaggaaggcct
gcacctgaggtgaagtggacccgggaacatggagaatctttagataaagctagcattgaa
tccaccagctcttatacgctgcttattgttggaaatgtaaacagattcgacagtggcaaa
tatatcctaactgtagaaaacagctcaggcagcaagtcggcatttgtcaatgtcagggta
ctagatacaccaggccctccacaggatctcaaggtaaaggaggtcactaaaacatctgtc
acattgacatgggagcctcctctccttgacggaggttcaaaaataaagaactatattgtt
gaaaagcgggaatcaacaagaaaggcatattcaactgttgcaacaaattgccacaagact
tcctggaaggtagaccagcttcaagaaggctgcagttactatttcagggttctcgctgaa
aatgaatatggcatcgggctgcctgctgaaaccgcagaatctgtgaaagcatcagaacga
cctcttcctccaggaaaaataactttggtggatgtcacaagaaacagcgtgtcactctca
tgggagaaaccagagcatgatggaggcagtcgaattctaggttacattgtagagatgcag
agcaaaggcagtgacaaatgggtcacatgtgccacagtcaaagtcaccgaagccactata
actggattaattcagggtgaagaatactctttccgtgtttcagctcagaatgaaaagggc
atcagtgatcctagacaactgagtgtgccagtaattgccaaggatcttgtcattccacca
gccttcaaactccttttcaatactttcactgtactggcaggtgaagacctaaaagttgat
gttccattcattggacgccctacaccagctgtaacatggcataaagatgatgtgccactg
aaacagacaactagagtaaacgcagagagcacagaaaataattcactactgacaataaag
gaagcctgccgagaagatgttggacattacacagttaaactgactaactcagctggtgaa
gccactgaaacccttaacattattgttcttgacaaaccagggcctccaactggaccagtt
aaaatggatgaagtgacagctgatagtattactctttcctggggcccacctaagtatgat
gggggaagttctatcaataattacattgtagaaaaacgagacacttccacaactgtctgg
caaattgtgtcagctactgttgcaaggacaacgataaaggcttccagattaaagactgga
tgtgaatatcagtttaggattgcagctgaaaacagatatggaaagagtacctacctcact
tcagagcctattgtagcccagtatccattcaaagttcctggtcctcctgggacaccattc
gtaaccctctcctccaaggacagcatggaagtacagtggaatgagccagtcagtgatgga
ggcagcaaagtcattggctatcatctagaacgcaaggaaagaaatagcatcctctgggtt
aagttgaataaaacacctattcctcacaccagatttaaaacaactggcctcgatgaaggc
attgaatatgaatttagagtctccgcagaaaatatcgtgggcatcggcaagccaagtaaa
gtgtcagaatgctatgtagcgcgtgacccatgtgatccaccagggcggccagaggcaatc
atggtcacacggaattctgtgactcttcagtggaagaaacccacttatgatggtggaagc
aagatcactggttatgttgttgaaaagaaagaattgcctgacggccgttggatgaaagcc
agttttacaaatgttattgacactcaatttgaagtaactggcctagttgaagatcataga
tatgagttccgggttatagctcgaaatgctgcaggagtgtttagtgagccttcagaaagc
acaggagcaataacagcaagagatgaggtagatccaccacgaataagtatggatccaaaa
tataaagacacaattgtggttcatgctggtgagttattcaggattgatgcagatatttat
ggcaaaccaataccaaccattcaatggataaaaggtgatcaggagctttcaaatacagct
cgattagaaataaagagcactgactttgccaccagtctcagtgtaaaggatgcagtacgc
atcgacagtggaaattacatattgaaggccaaaaatgttgcaggagagagatcagttacc
gtaaatgttaaagttcttgatagaccagggccacctgaaggacctgttgttatatcagga
gttactgcagaaaaatgcactctagcttggaaacccccactacaggacggtgggagtgac
atcataaattatattgtggaaagaagagaaaccagccgcttagtttggactgtggttgat
gccaatgtgcaaactctcagctgcaaggttactaagcttctggaaggcaatgaatatact
ttccgtataatggctgtaaacaaatatggtgttggcgaacctcttgaatctgagccagta
atggccaagaatccatttgtagtgccagatgcaccaaaggctccagaaatcaccacagtg
accaaggactcaatgattgttgtatgggaaaggccagcatctgacggtggcagtgaaata
cttggatatgttcttgaaaaacgggataaggagggcgttcgatggacaagatgccacaaa
cgtctgattggggaattgcgcttgagagtaactggactcttagaaaatcacaattatgaa
ttcagagtctcagccgagaacgccgctggacttagtgaaccaagcccaccttccgcttac
caaaaggcttgtgatcctatttataaaccaggacctccaaacaatcccaaagtcatagat
attaccaggtcttctgtcttcctttcttggagcaaaccaatatatgacggtggctgtgaa
atccaaggatacattgttgaaaaatgtgatgtgagtgttggcgaatggacaatgtgcact
ccaccaactggaatcaataaaacaaatatagaagtagagaagctgttggaaaagcatgaa
tacaacttccgtatctgtgctgttaataaagctggagttggagaacatgctgatgtccct
ggacctgttatagttgaagaaaaactggaagccccagacattgatcttgacctagaacta
aggaaaattataaatataagggcaggtggctctttaaggttatttgttcctattaaaggt
cgtcctacaccagaagttaaatgggggaagatggatggtgaaatccgagatgcagctata
attgatgtcactagcagtttcacctctcttgttctggacaatgtcaaccgatatgatagt
ggaaagtacactctcacattagaaaacagcagtggaacaaagtctgcctttgttaccgtg
agggtcctggacacaccaagtccacctgttaacctgaaagtcacagaaatcactaaagac
tcggtttcaattacgtgggaaccacctttgttggatgggggatccaaaatcaaaaattac
attgttgagaaacgtgaagccacaagaaaatcgtatgctgcagttgtaacaaattgccat
aagaattcttggaaaatcgaccaactccaagaaggttgcagttattactttagagtcaca
gctgagaacgagtttggtattggccttcccgcccacactgctgatccagttaaggttgca
gaagtcccacaacctccaggaaaaataactgtggatgatgtcaccagaaatagtgtctcc
ttgagttggacaaagcctgaacatgatggtggaagtaaaatcattcagtatattgtggaa
atgcaagctaagcacagtgagaaatggtcagagtgtgctcgtgtcaagtccctcgaagca
gtaattaccaacctaactcagggagaagaatatctttttagagttgttgctgtaaatgaa
aaggggagaagtgatcctaggtcccttgcagttccaatagttgccaaagatctggtcatt
gagccagatgtaagacctgcattccacagttatagtgtacaggttggccaggatttgaaa
atagaagtgccaatttctggacgtcctaagccaaccgttacctggactaaggacgatctt
cctctgaagcagactacaagaatcaatgttactgattcacttgaccttactgtactcagt
attaaagaaactcataaggatgatggtggacattatggaatcacggttgctaatgttgtt
ggtcagaaaacagcatctattgaaattataactctagataaacctgatcctccaaaagga
cctgttaaattcgatgaagtcagctctgaaagtattacattatcttggaaccctccgcta
tatacagggggctgccagatcaccaactatattgttcagaaaagagatacaaccaccaca
gtatgggatactgtttctgctactgttgccagaactacactcaaagtgaccaaactgaaa
actggtacagaataccaattcagaatattcgctgaaaacagatatggacaaagctttgcc
ttggagtctgatccaattgtagctcaatatccctacaaagaaccagggcctccaggcaca
ccatttgtcacaaccacttccaaagactccatggttgtacagtggcatgaaccaatcaat
aatggtggaagcccagtcataggttaccaccttgagaaaaaggaaagaaatagtattttg
tggacaaaagtcaacaaatctattattcatgacacccagtttaaagcagtcaatcttgaa
gaaggcattgaatatgaattcagagtttatgctgaaaatattgttggtgtaggcaaagta
agcaagaattccgaatgctatgtagccagagatccctgtgacccaccaggaaccccagaa
gcaataatggttaaaagaaatgaaatcactttacaatggaccaaacctgcatatgatggt
ggaagtatgatcacgggttacattgtagagaaacgtgatttgcctgagggtcgttggatg
aaagctagcttcacaaatgtcattgaaactcaatttactgtgtcaggtcttactgaagat
caaagatatgaattcagagttattgcaaagaatgcagctggtacaataagtaaaccctcc
gacagtactggaccaataactgccaaggatgaggttgaacttccaagaatttcaatggat
ccaaaattcagagacacaattgtggtaaatgctggagaaacattcaggcttgaggctgat
gttcatggaaagcccctacctaccattgagtggttaagaggagataaggaaattgaagaa
tctgctaggtgtgaaataaagaacacagatttcaaagctttacttatcgtaaaggatgcc
attagaattgatggtggacagtatattttaagagcttccaatgttgcaggttctaagtca
ttcccagtaaatgtcaaagtattagatagaccaggacctccagaagggccagtccaggtt
accggagtcacttctgaaaaatgcaatttaacatggtctccaccacttcaagatggtggc
agtgacatttctcactatgttgttgaaaagagagaaacgagtcgacttgcctggactgtt
gttgcttcagaagttgtgaccaactccctgaaaattaccaaactcttagaagggaatgaa
tatattttccgtataatggctgtcaacaaatatggggttggagagcctttggaatctgca
ccagtactaatgaaaaatccatttgtgcttcctggaccaccaaaaagcttggaagtcaca
aacactgccaaggactccatgactgtctgttggaaccgtccagatagtgatggtggaagt
gagattattggttacattgtagagaaaagagacagaagtggcattaggtggataaaatgt
aataaacgccgcattacagatttgcgcctaagagtaacaggattaacagaagatcatgag
tacgaattcagagtctctgcagaaaatgctgctggagttggagaaccgagtccagctaca
gtttattataaggcttgcgatcctgtgttcaaacctggcccacccatcaatgcacatgtt
gtagacaccactaaaaattcaattacacttacctggggtaaacccatctatgatggtggc
agtgagatcctgggatatgtagtagaaatatgtaaagcagatgaagaagaatggcaaata
gttactccacagactggcctgaaagccactcgatttgaaatttcaaaactcactgaacac
caagagtacaaaatacgagtctgtgccctcaataaagttggtttaggtgaggctacgtca
gttcctggtactgtgaaaccagaagataaactcgaagcacctgaactggaccttgactct
gaattaaggaaaggaattgttgtaagagctggtggatctgccagaattcacattccattc
aaaggtcgtccaacacctgacatcacttggtctcgagaggaaggtgaattcacagataag
gtccaaattgaaaagggagtaaactatacccaactatcaatagataactgtgatagaaat
gatgctggaaaatacattctcaagctggaaaatagcagtggatctaaatctgcttttgta
actgtgaaagttcttgacactccaggaccaccacagaatttggcagtcaaagaagtgaaa
aaagattctgtcattcttgtatgggaaccacccatgattgatgggggcgcaaaggtcaag
aactatgttattgacaaacgtgagtcaaccagaaaagcatatgctaatgtgagtaataaa
tgcagcaaaacaagccttaaagttgagaatcttacagaaggggccatttattactttaga
gttatggctgaaaatgaatttggagttggcgttccagtggaaactgttgatgctgtgaaa
gctgctgaacctccttccccaccaggaaaggttacactcactgatgtgtcccagaccagt
gcatcgcttatgtgggagaaacctgaacatgatggtgggagcagaatcctggggtatgtt
gttgaaatgcagcccaaaggaactgaaaaatggagtgttgtggctgaatccaaagtctgt
aatgcagttattactggtttgagttctggacaagaatatcacttccgtgtcaaggcttat
aatgagaaaggaagaagcgatccaagagtgcttggtgttcctgtcatagccaaggacttg
accataccgcctagtttcaagttaccatttaacacatatagtgtccaagctggagaagat
cttaaaattgaaattccagttattggccgaccaagacctgaaatttcatgggtcaaagat
ggtgagcctcttaaacagacaacaagagtaaatgttgaggaaacagctaattcaactatt
ttgcacattaaagaaactaacaaagatgattttggaaagtataccataacagcaacaaat
attgccggtacagcaacagaaaatctcagcattattgttttggaaaagcctggacctcca
gttggaccagttcggtttgatgaagttagtgcagactttgtggtcatatcttgggaacct
ccagcctatactggtggctgccaaataagcaactacattgtagagaagcgagatacaacc
accaccacttggcaaacggtatcagcaacagttgcaagaacaacaattaaaatagccaaa
ctgaaaacaggcactgagtaccagtttagaatttttgcagaaaacaggtatggaaaaagt
acccacctggattctaaaccagttattgtacaatatccatttaaagaacctggaccacct
ggaactccttttgtgacatcagtctcaaaagatcaaatgcttgtgcaatggcatgagcca
gttaatgacggaggtagtaaagttattggctaccatcttgaacagaaagaaaagaacagc
attttatggatcaaattaaataagactcccattccagacaccaaattcaaaacaactggc
cttgatgaaggcattgagtatgagttcagagtttctgctgaaaatattgttggcatcggc
aagcctagcaaagtgtcagaatgctttgttgcccgtgatccatgtgacccacctggtcgc
cctgaagccattgttattacaagaaacaatgtcacactgaaatggaagaaacctgcctat
gatggtggcagcaaaataacaggttatattgtagaaaagaaagacctacctgatggccgt
tggatgaaagccagctttaccaatgtattagaaactgaatttacagtgagtggacttgta
gaagaccaaagatacgaatttagagtaattgcaagaaatgcagcaggcaactttagtgaa
ccatctgaaagcactggtgccattactgcaagagatgaaattgatgcaccaaatgcctca
ctggatccaaaatataaagatgttatcgttgttcatgcaggagagacttttgtcctggaa
gctgatatccgcggcaaacccatacctgatattgtttggttaaaagacggaaaagagctt
gaagaaacagctgctaggatggaaattaagtctactattcagaaaacaactcttgttgtc
aaagactgtatacgtactgatggaggacaatatattctgaaactcagcaatgttggtggt
acaaagtctataccaatcactgtaaaggtacttgacaggccagggcctcctgaagggcct
ctgaaagtttctggggttactgctgaaaaatgttacttggcatggaacccacctttgcaa
gatggtggtgctaatatttcacattacatcattgaaaagagagagacaagcagactctca
tggacccaggtttcaactgaggtacaggcccttaactacaaagtcactaaacttcttcct
ggaaatgagtacattttccgtgtcatggctgtgaataaatatggagttggagagcctttg
gaatctgaacctgttatagctcgtaatccttataaaccaccaggtcctccttcaccacct
gaagtctcagcaatcaccaaagattctatggtagtaacgtgggcacgcccagtggatgat
ggaggtgctgaaattgagggatacattcttgaaaaacgagataaggaaggcgttagatgg
accaagtgcaacaagaaaacactaacagatctccgattcagggtaactgggcttaccgaa
ggtcattcctatgaattcagagttgctgctgaaaatgcagctggtgtgggtgaacccagc
gagccatctgttttctaccgtgcatgtgatgctttgtatccaccaggtccaccaagtaat
ccaaaagtgacagacacttccagatcttctgtctccctggcatggaataagccaatttat
gatggtggtgcccctgttaagggctacgttgttgaagtcaaagaagccactgctgatgaa
tggacgacttccactccaccaacaggattacaaggaaagcagttcacagtgaccaacctt
aaagaaaatactgaatataacttccgcatttgtgccatcaattctgaaggtgtaggtgaa
cctgcaactatacctggttcagttgttgctaaagacaggttagagccaccagaaatagaa
cttgatgctgatctcagaaagatggtcattctgcgtgcaagtgctactttacgcttattt
gtcactatcaaaggtcgaccagaacctgaagttaaatgggaaaaagccgaaggcattctc
actgagagggcccagattgaggtgaccagctcatacacaatgttggtgatcgataatgtt
accagatttgacagcggtcgatataatctgacactagaaaataacagtggctctaaaaca
gcttttgttaacgtcagagtccttgactcaccaagtgcccccgtgaatttgagtgtaaaa
gatgtgaagaaagactcggtgacattgtcttgggaaccaccacttatcgatggtggagcc
aaggttacaaactacattgtcgaaaaacgagaaactacaagaaaagcctatgctactgtt
acaaacaattgcactaagactacttttaaaattgaaaatctacaagaaggatgctcttac
tacttccgagtcttggcttgcaatgaatacgggattggtttgccagctgaaacaagtgaa
cccgttaaagcttctgaaccacccctcccacctggaagagtaactcttgttgacgtgacc
agtaacacagctacaattaagtgggagaaaccagaaagtgacggtggcagcaaaattact
ggttatgtggttgaaatgcagactaaagggagtgaaaaatggagcacttgcacacaagtt
aagactctagaagcaactatatctggcctaacttcaggagaagagtatatcttcagggta
gctgctgttaatgaaaaaggaagaagtgatccaagacaacttggagtgccagtaattgca
agggatattgaaataaagccttcagttgagcttcctttccatactttcaatgtaaaggct
agagaccaacttaagattgatgttccatataaaggaagacctcaagctactgtaagctgg
aaaaaagatggtcagactctaagagaaacaactagagtcaatgtttcttcttcaaagact
ataacatcactatctattaaggaagcctcaagagaagatgttggaacttacgaattatct
gtttcaaacagtgctggatccataacagttcctattactgtaattgtccttgacagacca
ggacctccaggacctatacatattgacgaggtcagttgtgacaatataaccatttcttgg
aatcctccagaatatgatggtggctgccaaattagcaattacatcgttgaaaagagagaa
accacttctacaacttggcatgtagtttcacaagcagttgcgagaacatctattaaaata
gttcgcctgacaacaggaagtgagtatcagttccgtgtctgtgcagaaaaccgctatgga
aagagcacctacagtgactctccagctgttgttgcagagtatccattcagccccccaggt
cctcctggtactcctaaagttgtgcatgccacgaaatctaccatgattgtaacctggcaa
gtgccagttaatgatggaggaagtcaagtaattggctatcaccttgagtataaagaaaga
agcagcattctttggtcaaaagcaaataaaatcctcattgctgatactcaaatgaaagtc
tctggccttgacgaaggactgatgtatgagtatcgtgtatatgctgagaatattgctgga
attggtaaatgcagcaagtcttgtgaaccagtccctgcaagagatccttgtgaccctcct
ggacaacctgaagtcacaaatatcacaagaaaatcagtgtcacttaaatggtctaagcca
cattatgacggtggagctaagatcacaggatacattattgaacgtagagaactaccagat
ggccggtggctgaagtgcaattttactaacgtacaagaaacatactttgaagtaactgaa
cttactgaagatcaacgttatgaattccgggtttttgcaaagaatgctgccgactctgtt
agtgaaccatctgaatccactggaccgattactgttaaagatgatgttgaggctccaaga
attatgatggatgtcaagttccgagatgttattgttgtcaaagctggagaggttcttaag
ataaatgcagacattgcagggcgacctctgccagtaatttcctgggccaaggatggtgta
gaaattgaagaaagagcaagaacagaaattgtctcaacggactataatactttgttaaca
gtgaaagactgtgttagacgagacactgggcaatacatactaacactgaagaatgttgca
ggaactcgttctgtggcagtcaattgcaaggtacttgataagcctggcccaccagccgga
ccacttgaaatatatggtctcactgctgagaaatgctctctttcctggggaccgccccaa
gaaaatggtggtgcagatattgactattacattgtagaaaaacgtgaaacaagccgcctt
gcatggacaatatgtgaaggagagttaaggacaacatcctgtaaagtaaccaagttactc
aaaggcaatgaatacatctttagagtaacaggtgttaataaatacggtgttggtgagccc
ctcgagagtgtggctgtaaaggcactagatccatttacagttccaagtccacccacatct
ttggaaattacctctgtgaccaaagattccatgacactttgctggtcaagacctgagagt
gatggaggtagtgaaatttctggatatataatagaaaggcgagagaaaaacagcgtacga
tgggtgcgtgtaaacaaaagaccagtttatgatctgagagtgaaatcaacaggacttcgg
gaaggatgtgaatatgagtatcaggtttatgcagaaaatgctgctggcctaagccttcca
agcgaagcctctcccttaattcgggcagaagatccagtgttcttaccatctcctccagct
aaacccaaaattgtggactcaggcaagacaaatataactattagctgggttaagccctta
tttgatggtggggccccagtaaccggatacactgtggaatataaaacgtctgatgaaact
gactggaaaactgccattcagaacttaagaggcacagaatatacaataagtggactaaca
acaggagctgaatacgttttcagagtaagatccatcaataaggtcggtgctagtgatccc
agtgatagctccgatccccagatagcaaaggaaagagaagaagaacctgtatttgatctt
gacagtgagatgaagaagaccttgattgtcaaggccggtgcctcatttactgtgactgtg
cctttccgaggaagaccagtacccaatgtctcgtggagtaagccagacactgacctccgc
actagagcctatattgattccacagactctcgtacatcacttactattgaaaatgccaac
agaaatgattctggaaaatacacattaacgattcagaatattttgagtgctgcttcgctc
accttagttgtcaaggttttagattctcctggacctccggctaatatttctgtacacgat
gtcaccaaagagtctgcagtgttatcctgggatgttcctgaaaatgatggtggagcacca
gtgaagaattaccacatagaaaaacgtgaggccagtaagaaagcatgggtctctgtgacc
aacaactgtaaccgcctctcctacaaagttaccaacttacaagaaggggcgatttactac
ttcagagtctctggacaaaacgagtttggtgttggtgtaccagctgaaacaaaggatgga
gtaaaaataacagaaaaaccaagcccacctgaaaaacttggagtaacaagtgtatccaag
gatagtgtttccctgacctggctgaagccagaacacgatggtggaagcagaatcgtacat
tatattgttgaagcactagaaaaaggacataaaaattggtttaaatgtgcagtggtcaag
tcaacccatcacgttgtttctggtctgagggagaattctgaatactttttccgggtgttt
gctgaaaatcaagctggtctgagtgacccaagagagcttctgcttcctgttcttattaag
gagcaactagaaccacctgaaatcgatatgaagaatttcccaagtcaaaccgtatatgtc
agagctggttcaaaccttaaagttgacattccaatttctggaaaaccactgcccaaagtg
accttatcaagagatggtgtccccctgaaagcaaccatgagatttaacactgaaattact
gctgagaacctcaccatcaatctcaaagaaagtgttgctgctgatgctggaagatatgag
atcactgctgccaactctagtggaacaacaaaaactttcattaacatcattgtcctggac
aggcctggtcccccaactggccctgttgttattagtgatataactgaagaaagtgtgact
ctcaaatgggagccacctaagtatgatggtggaagtcaggttaccaattatattgtactc
aagagagagacaagtactgcagtatggactgaagtgtccgcaacagttgcaagaaccacg
attaaagtcatgaaactgaccagaggagaagaataccaattccgcatcaaggcagaaaac
cgctttggcatcagcgatcacatagattcagcttgtgtggttgtcaaactcccatacaca
acacctggaccaccatctacaccatgggtcactaatgtcactcaggaaagcatcactgtg
agctggcatgaaccagtatccaacggaggcagtgcagttataggttatcacctggaaatg
aaagacagaaacagtattttatggcaaaaagtcaacaaaatgatcatccgcacaactcac
ttcaaagtcacaacaatcagtgctggacttatttatgaattcagagtatatgcagaaaat
gctgctggtgttggaaagcccagccatgcttccgaaccagtcctagccattgatgcctgt
gaacccccaagaaacatccgtatcactgatatttcaaagaactctgtcagcctttcatgg
caacaaccagcttttgatggaggaagcaagattacaggctacattgttgagagacgagac
cttccagatggcagatggaccaaggccagcttcaccaatgttattgagactcaattcatt
gtctctggcttgactcagaattctcagtacgaattccgtgtctttgctaggaatgccatt
ggttccatcagcaatccatccgaggttgtaggccccgttacatgcattgattcttatggt
ggacctgtaattgatttgcctctagaatatacagaagttgtcaaatacagagcaggtaca
tctgtgaagctcagagctggcatttctggcaaacctgagcctacaattgagtggtttaaa
gatgataaagagttacaaaccaatgcacttctgtgtgttgaaaataccactgaccttgcg
tctatactcatcaaagacgcaaatcgccttaatagtggaagatatgaattaaaactaagg
aatgccatgggctcagcttcagccaccatcagagtgcagatccttgacaaaccaggacct
ccaggtggaccaattgaatttaagacggtcactgctgaaaagatcactctgctctggcgg
cctccagtagatgatggcggtgcaaaaatcactcactacgttgtggaaaagcgtgaaaca
agccgcgttgtgtggtctatggtgtctgaaaatttggaagagtgcatcattaccaccacc
aaaattatcaaaggaaatgaatacgtcttccgggttcgcgctgtgaacaaatatggaatt
ggtgatccactggaatctgatccagtggtagcaaagaatgcatttgttacacctgggcct
ccaagcataccagaggtgacaaagattaccaagaattcaatgactgttgtctggaacagg
ccagttgcagatggtggtagtgaaataagtggctatttccttgaaaaacgagacaagaag
agtctaggatggtttaaagtactcaaggagtctatccgtgacaccagacagaaagtggca
ggactcacggaaaacagtgactatcaataccgagtttgtgctgtaaatgctgctggacag
ggtccattttcggaaccatctgacttctacaaagctgctgatcctattgatcctccaggc
ccaccagctaagataagaatcgcagattcaactaaatcatccatcactcttggctggagt
aaacctgtctatgatgggggcagtgctgtgactggatatgttgttgcaatgagacaagga
gaagaagaggaatggactgttgtctctaccaaaggagaagtcagaactacagaatatgtg
gtatctaacctgaaacctggagtcaattactatttccaggtatccgctgtaaactgtgct
ggacaaggagaacctatagaaatgactgagcctgtacaagccaaagatatacttgaggaa
ccagagatcgacctagatgtggctctcagaacctctattatagctaaagccggtgaagat
gtacatgtgttcataccgtttaaaggcagacctccacctactgtcacatggagaaaagat
gagaagaatcttggcagtgatgccagatatagcattcaaaacactgattcatcttcatta
ctcattattcctcaagtcactcgcaatgatacgggaaaatatattctcacaatagaaaat
ggagttggtcaaccaaagtcttcaactgtgagtgtcaaagtgcttgatacgccagccgcc
tgccagaaactacagattaaacatgtttctcaaggcacagtcacattgttctgggatcct
cctctcattgatggaggatctcccataattaattacatcattgaaaagagagatgccacc
aagagaacatggtcctcagtgtcacacaaatgttccagcacaacctttaaggtaaaagat
ttgtcagagaaaactccattcttcttcagagttctcgcagaaaatgaaattggaatcggg
gagccttgtgaaactacagagccagtgaaggctgctgaagtaccagctccaatacgtgat
ctctcagtgaaagattcaacaaagacatctgttaccctgagctggaccaagcctgacttt
gatggtggtagtgtcatcacagaatatgttgtggaaaggaaaggcaaaggtgaacaaaca
tggtcatatgctggcataagtaaaacatgtgaaattgaggttggccaacttaaggaactg
tcagaactggaattcagagtgtctgccaaaaatgagaaaggactgagtgatgctgtcact
attgggccagttacagtgaaagaacttgtaattacacctgaagttgacctgtcagaaatc
cctggggcgcaagtcgctgtgagaattgggcataatgtgcaccttgaattaccttacaaa
ggaaaacccaaaccatctatcagttggctgaaagatggtttgccattgaaagaaagtgaa
tatgttcgtttcagtaaaactgaaaacaaaattactttgagtattaagaatgtcaagaag
gaaaatggagggaaatacaccgttattcttgataatgcagtttgtagaacctcagttccc
attacaatcatcacacttggcccaccatcaaagcccaaagggcccgttcgatttgatgaa
atcaaggctgacagtgtcatcatgtcatgggatgtgcctgacgatgatggaggaggagaa
attacttgttacagcattgagaagcgggaagcttcacaaaaaaattggaagatggtgtgc
tcgagtgttgccaggacaactttcaaagttcctaatctagtcaaagatgctgaataccag
tttagagttagggcagaaaacagatacggagtcagccagccacttgtctcgaccatcatt
gtggcaaaacaccagttcaggattcctggccctccaggaaagccagttatatacaatgtg
acttctgatggaatgtcactaacctgggatgctccagtttatgacggtggtgcagaagtt
actgggttccatgttgaaaagaaagaaagaaatagcatcctctggcaaagaattaataca
tcaccaatatctggaagagaatacagagctactggactaatggaaggcctggattaccag
ttccgtgtatatgctgaaaattctgccggcctaagcgcacctagtgacccaagcaaattt
accttagctgtttccccagtagacccacctggcactcctgactacattgatgtcacccgg
gaaaccatcacactgaaatggaacccaccattgcgtgatggaggcagtaagatcgtggcc
tacagcattgagaaacgacaagggagcgatcgctgggttagatgcaactttactgatgtc
agtgaatgtcagtacacagtgacaggacttagtcctggggatcgatttgagttcagaata
attgcaagaaatgctgttggaactataagcccgccctcacagtcttctggcattattatg
acaagagatgaaaatgttccaccaatagtagagtttggccctgagtactttgatggtctt
actattaagtctggagagagccttagaattaaagctttggtgcaaggacgaccagtacct
cgagtaacttggttcagagatggagtagaaattgagaagaagatgaatatggaaataact
gatgtccttggatccaccagcctctttgttagagatgctacccgggaccatcgtggtgta
tatacagtggaagccaaaaatgtatctggcaccgcaaaagcagaaattaaagtcaaagta
caagatacaccaggaaaagtagttgggccaataagattcaccaacattactggcgagaag
atgaccctatggtgggatgctccactcaatgatggctgtgctcccataactcactacatc
attgaaaaacgggaaaccagcagacttgcttgggcactaattgaggataattgtgaaacc
ctcagttatactgccgttaaactaataactggcaatgaataccaattccgtatttctgca
gttaacaagtttggtgttggcaggccacttgattctgaccctgtggttgctcaaatacaa
tacactattcctgatgcccctggcactccagaacctaccaatgttacaggcaatagcatt
actctgacgtgggcaaggccagaatcagatggtggcaatgaaattcaacaatatatcctt
gaaaggagagaaaagaaaagcacacgatgggtaaaagtgatcagcaaacgaccaatctct
gagacaagattcaaagtcactggtctgacagagggcaatgagtatgaattccacgtcatg
gctgaaaatgatgcaggagtaggacctccaagtgggatctcaagactaatcaaatgtaga
gagccagtcaacccaccaagtgctcccactgtggtcaaagtgacagatacatcaaagaca
actgtgagcttagaatggtctaagccagtgtttgatggaggcatggaaataattgggtat
attattgaaatgtgcaaagctgacttaggagactggcacaaggtgaatgcagaggcatgt
gtgaaaacaagatacacagtcactgatctacaagccggtgaagaatacaaattccgggtg
agtgctatcaatggtgctggaaaaggagacagctgtgaagtgaccggcacaattaaagca
gttgaccgattaacagctcctgagttagatatcgatgcaaacttcaagcagactcacgtt
gttagagctggggccagtattcgcctcttcattgcctaccagggtagaccgactcctaca
gctgtgtggaccaaacctgactctaacctaagcattcgggccgatatccatacaacagag
tccttcagcaccctcactgtggaaaactgcaacagaaatgacgcagggaaatataccctc
accgtggaaaacaacagtggtagtaagtcagtcacattcaccgtaaaggtgctagactct
ccaggcccacctggccccattactttcaaggacgtgaccaggggatctgttacattgatg
tgggatgcccctctccttgatggtggcgcccgcatccatcactacgtggtagagaaacga
gaagcaagtcgtcgtagctggcaggttgtcagtgaaaaatgcattcgtcagatcctcaag
gtcaacgacctggtagaaggtgttccgtactatttccgtgtttctgcagaaaacgagtat
ggtgttggtgaaccctatgaaatgccagaaccaatggtagccacagaacagcctgctcca
cctaagagacttgatgttgttgacacaagcaaatcctccgcagtcttagcttggcttaaa
cctgaccacgatggaggcagccggattactggctacctgctcgaaatgagacaaaaggga
tctgacttctgggttgaagcaggtcacaccaaacagctgactttcacagtggagcgcctt
gttgagaacactgaatatgaattccgtgtgaaggccaagaatgatgctggctacagcgaa
cccagggaagccttctcttctgtcatcatcaaggagcctcaaattgagcccactgctgat
ctcactggaattaccaatcagctcataacttgcaaagcaggaagcacatttaccattgac
gtgccaatcagtggtcgtcctgcccccaaagtaacatggaagctcgaggaaatgagacta
aaggagacagatcgagtgagcatcacaacaacaaaagacagaaccactctgtctgtcaag
gacagcatgagaggtgactctggaagatacttcttgactctggaaaacacagctggagtt
aaaacatttaccatcacagttgtggtcattggaaggccaggtccagtaactggccccatt
gaggtctcatctgtctcagccgaatcatgtgtcctgtcatgggctgaacctaaagatgat
ggaggcaccgatattactaattatatagttgaaaagcgtgagtcgggtacaacagcttgg
cagcttgtcaattccagtgtcaagcgcactcagattaaagtcactcatctcacaaaatac
atggaatattctttccgtgtcagttcagagaacagatttggtgtcagcaagcctctagaa
tcagcaccaataattgctgaacatccatttgtcccaccaagcgctcctaccagacccgaa
gtctactatgtgtctgccaatgccatgtctattcgttgggaagaaccctaccatgatggt
ggcagtaaagtcattggctactgggttgagaagaaagaacgtaataccattctttgggtg
aaagaaaacaaagtgccatgcttagagtgcaactacaaagtgaccggtctggtagaagga
ctggagtatcagttcagaacatatgcgctcaatgctgcaggggttagcaaagccagtgaa
gcttcacgacctatgatggctcaaaacccagttgatgcaccaggaagaccagaggtgact
gatgtcacaagatcaacagtgtcactgatttggtcttccccagtgtatgatggaggcagc
aagattgttggctacatcatagagcgtaagccagtcagtgaagttggagacggtcgctgg
ctgaagtgcaactataccattgtatctgacaatttcttcactgtgactgctctcagtgaa
ggagacacttacgaattccgtgtgttggccaagaatgcagcaggggtaattagcaaggga
tcagaatctacaggccccgtcacttgccgagatgaatacgctcctcccaaagctgaactg
gatgccagattacagggtgatctggttaccatcagagcaggctcggatcttgttcttgat
gctgcagttggtggcaaacctgaacccaaaattatctggaccaaaggggacaaggaacta
gatctctgtgaaaaaatctctttgcagtatactggcaaacgagcaactgctgtgatcaaa
ttctgtgacagaagtgacagtggaaaatacactttaacagtgaagaatgccagtgggacc
aaggccgtgtctgtcctggtcaaagttcttgattcccctggcccatgtggaaagctcacc
gtcagcagagtaacagaggagaagtgcactttagcctggagccttcctcaggaagatgga
ggagcagaaataacacactacatcgtggaaagacgtgagactagcaggctcaactgggtg
attgttgaaggcgaatgcccaaccctatcctatgtagttaccagactcatcaagaacaat
gaatacatattccgagtgcgagcagtaaacaaatatggccctggtgtgcctgttgagtca
gagccgattgtagccagaaactcattcactattccatcacaacctggcatgcctgaagaa
gttggagctggcaaagagcatatcatcattcagtgggtaaaacctgaatctgatggtggc
aatgatatcagcaactacctagtagacaaacgtgagaagaagagcttgcgctggacacgt
gtcaacaaagactatgtggtgtatgataccaggctgaaggtgactggcctgatggaaggt
tgtgactaccagttccgggtgactgcagtgaatgctgctggtaacagtgaacccagcgaa
gcttccaactttatctcatgcagagaaccatcatatactcctggaccaccttctgctcca
agggttgtggataccaccaagcacagcattagtttggcatggaccaagcccatgtatgat
ggtggtgttgacatcacaggatatgttcttgaaatgcaagagaagggcactgatcagtgg
taccgagtgcataccaacgccacaataagaaatactgaattcactgtgctagaccttaaa
atgggccagaaatattccttcagagttgctgctgtgaacgtgaagggtatgagtgaatat
agtgagtcaaccgccgaaattgagcccgtggaaagactagaaataccagatcttgagctt
gcagatgatctaaagaagactgtgacactcagagctggggcctcattgcgcctgatggtg
tctgtatctggaagaccacctcctgtcatcacatggagcaagaaaggcattgaccttgca
agtcgggcaattattgacaccactgagagctactctttacttattgtggacaaagttaac
cggtacgatgctggaaaatacaccattgaagccgaaaatcaatctggcaagaaatcagca
acagttcttgttaaagtatatgatactcctggtccttgtccttcagtgaaagttaaggaa
gtatccagagattctgtgaccattacttgggaaattcccacaattgatggtggagctcct
gtcaacaattacattattgagaagcgtgaagctgccatgagagcattcaaaacagtaact
accaaatgcagcaagacactttaccgaatttctggacttgtagaaggatgcatgtactat
ttcagagtgttgccagaaaatatctatggcattggagaaccttgtgaaacatctgatgca
gttctagtctccgaagtgcctttggtgcctacaaagctagaagtggtggatgtcaccaaa
tcaactgtgagtcttgcctgggaaaaaccactctatgatggtggtagccgactcactgga
tatgttctcgaggcctgcaaagctggcactgagagatggatgaaggttgccaccttaaaa
cccacagtcctagagcacacagttatttccttaaatgaaggtgaacagtacttatttaga
gtaagggcacaaaatgagaaaggcgtgtcagaaccaagagagatcgtcacagccgttact
gtacaagatctcagagtgttgccaaccatcgatctttccacaatgcctcaaaagaccatc
catgtcccagcgggcagaccagtagagctggtgataccaatcgctggtcgcccacctcct
gctgcttcctggttctttgctggttctaaactaagagaatcagaccgtgtcacagttgaa
actcatactaaagtagctaaattaaccatccgtgaaaccactatcagagatactggagaa
tacacacttgaattgaagaatgtaactggaactacttcagagaccattaaagttatcatt
cttgacaagcctggtccaccaactgggcctatcaagattgatgaaattgaagctacttca
gttaccatttcctgggaaccacctgaattggatggtggtgctccactgagtggctatgtg
gtagaacaacgtgatgcccatcgtccaggatggctgccagtgtctgaatcagtgactaga
cagacatttaagtttaccagactcactgaaggaaatgagtatgtgttccgtgtggctgca
accaaccgcttcgggattggatcttacttgcaatctgaggtcatagaatgtcgcagcagc
atcagtattcctggacctccggaaacattacagatatttgatgtctcccgtgatggcatg
acactcacttggtatccaccagaggatgatggtggctcccaggtgactggatatattgtg
gagcgcaaagaagtgagagcagatcgatgggtccgcgtaaataaagtaccagtaaccatg
acacggtaccgttccactggccttattgaaggcttagaatatgaacaccgtgtcacagcc
attaatgcaagagggactggaaaaccaagtcgtccttccaaacccatcgttgccatggat
ccaattgctcctccaggaaagcctcaaaacccaagagttactgatacaacaaggacatca
gtctccctggcctggagtgttccagaagatgaaggaggatctaaagtcacaggctacttg
attgaaatgcaaaaagtagatcaacatgaatggaccaaatgtaacaccaccccaaccaag
attcgggagtatactctaacacacctacctcagggcgctgagtacagattccgtgtccta
gcttgtaatgctggcggacctggggagcccgccgaggtaccaggaacagtcaaagtcacc
gaaatgcttgaatatcctgattatgaactagatgaaagataccaggaaggtatctttgta
agacaaggtggagtcatcagacttaccataccaattaaaggaaaaccattcccaatatgc
aaatggaccaaggaaggccaagatattagtaagcgtgccatgattgcgacatctgaaacg
cacactgagcttgtgatcaaagaagcagacagagatgattctggcacttacgacctggtt
ctggaaaacaaatgtggcaaaaaggctgtttatatcaaggtcagggtgataggaaacccc
aacactccagaagggccacttgaatacgacgacatacaagctcgctctgtaagggtcagc
tggagaccacctgctgatgatggtggtgctgacatcttgggatacatcctcgagagacga
gaagtgcctaaatctgcctggtataccattgattccagagtccgaggtacatctctggtg
gtaaaaggcctcaaagaaaacgtagagtaccatttccgtgtttcagctgaaaaccagttt
ggaattagcaaacccttgaaatctgaggaaccagtcataccaaaaacaccactgaaccct
ccggagcctccaagcaatcctccagaagtactggatgtgaccaagagctctgtcagcctg
tcctggtcacggcccaaagacgatggtggttctcgagttacaggctactacattgaacgc
agggagacatcaactgacaagtgggtcagacacaacaagactcagataaccaccacaatg
tacaccgtcaccgggcttgttcctgatgctgaatatcagttccgcatcattgcacagaat
gatgttggcctaagcgagaccagccccgcttctgaaccagttgtttgcaaagatccattt
gataagccaagccaacctggagaacttgagattctttcaatatccaaagatagcgtcact
ctacagtgggagaaacctgaatgtgacggtggcaaagaaatccttggatactgggttgaa
tatagacagtctggagacagtgcctggaagaagagcaataaggaccgcatcaaggatagg
caattcacgatagggggtttgctggaagctactgaatatgaattcagggtttttgctgag
aatgagactggacttagcagacctcgaagaaccgctatgtctgtaaagactaaactaact
tctggagaggccccgggagtacgcaaagaattgaaggatgttaccaccaaattgggtgaa
gctgctcaactctcatgccagattgttgggaggcctctacctgacattaaatggtaccga
ttcggtaaggagctcatacaaagccggaagtacaaaatgtcttcagatggacgcacacat
acgctgacagtaatgacagaggaacaagaagacgaaggtgtctatacctgcatggctacc
aatgaggttggagaagtagaaaccagtagtaagcttcttttgcaagcaacaccacagttc
catcctggttacccactgaaagagaaatactacggtgctgtgggttcaacacttcgactt
catgttatgtacattggtcgtccagtacctgccatcacttggttccatggccagaaactt
ttgcaaaactcagaaaacattactattgaaaacacggagcactatactcatctcgtcatg
aagaatgtccaacgtaaaactcatgctgggaaatacaaagttcagctcagcaatattttc
ggaacagtcgatgctatccttgatgtggaaatacaagataaaccagacaaacctacagga
ccaattgtgattgaagctctattgaagaactctgtggtgatcagctggaaaccacctgca
gatgatggaggctcctggatcaccaattatgtagtggagaaatgtgaggccaaggaaggg
gctgaatggcaattggtgtcttcggccatctcagtgacaacctgtagaattgtgaacctc
acagaaaatgctggctattacttccgggtttcagctcagaacaccttcggcatcagcgac
cctctggaggtcccctcggttgtgatcattaagagtccatttgaaaagccaagtgctccc
agcaaaccaacgattactgctgtcacaaaagattcttgtgttgtggcttggaagccacct
gccagtgatggaggtgcaaagattagaaattactaccttgagaagcgtgagaagaagcag
aataaatggattgctgtgacaacagatgaaattcgagaaaccgtcttttcagtgcaaaac
cttattgaaggtcttgaatatgagttccgtgtgaaatgtgaaaacctaggtggggaaagc
gaatggagtgaaatatcagaacctgtcactcccaaatctgatgtcccaattcaggcacca
cactttaaagaggaactcagaaatctacatgtcagatatcagagcaatgctactttggtc
tgcaaagttactggtcacccgaaacctattgtgaaatggtacagacaaggcaaagaaatc
attgcagatggattaaagtacaggattcaggagtttaagggtggctaccaccagctcatc
attgcagctgtcacggatgatgatgccacagtttaccaagtcagagctaccaaccaaggg
ggatctgtgtcgggcactgcctccttggaagtggaagttccagctaagatacatttgcct
aaaactcttgaaggcatgggagcagttcacgctctccgaggtgaggtggtcagcatcaag
atccctttcagtggcaaaccagatcctgtgatcacctggcagaaaggacaagatctcatt
gacaataatggccactaccaagttattgtcacaagatctttcacatcacttgttttcccc
aatggagtggagagaaaagatgctggtttctatgtggtctgtgctaaaaacagatttgga
attgatcagaagacagttgaactggatgtggctgatgttcctgacccacccagaggagtc
aaagttagtgacgtctcacgagattctgtcaacttaacatggactgagccagcttctgat
ggcggcagcaaaatcaccaactacattgttgaaaagtgtgcaactactgcagaaagatgg
atccgtgtaggacaggcccgagaaacccgttataccgtgatcaacttatttggaaaaaca
agttaccagttccgtgtcatagctgaaaataaattcggcctgagcaagccttctgagcct
tcagaacctactataaccaaagaagataagaccagagctatgaactatgatgaagaggta
gatgaaaccagagaagtttccatgactaaagcatctcactcttcaaccaaggagctctat
gagaaatatatgattgccgaagatctcgggcgtggtcagtttggaatcgtccaccgttgt
gttgaaacttcctcaaagaagacatatatggccaaatttgttaaagtcaaagggactgat
caggttttggtaaagaaggaaatctccatcctaaacatcgctaggcacagaaacatctta
tacctccatgaatcatttgaaagcatggaagaattagtcatgatctttgagttcatatca
ggacttgacatatttgaacgcattaacacaagtgcttttgaacttaatgaaagagaaatt
gtaagttatgtccgccaggtctgcgaagcacttgagttcttacatagtcataatattgga
cactttgacattaggccagacaatatcatttaccaaacaagaaggagctccgtcattaaa
atcatagaatttggtcaagcccgtcagctgaagccaggggacaactttaggcttctgttc
actgcccctgaatattatgcccctgaagtccaccaccatgatcttgtcagcacagccaca
gacatgtggtcacttggaacactggtctatgtgctgttgagtggtaccaatccattcctg
gctgaaactaaccaacagataattgagaacatcatgaatgctgaatttacttttgatgaa
gaagcattcagagagattagccttgaagccatggattttgttgaccggctgttggtgaaa
gagagaaaatctcgcatgacagcatctgaggcactccagcacccatggctgaagcagaag
acagaaaaagtcagtactaaagttatcagaacattaaaacaccggcgttactatcacacc
ctgatcaagaaagatctcaacatggttgtatcagcagcccggatctcctgtggtggtgca
attcgatctcagaagggagtgagtgttgctaaagttaaagtagcatccattgaaattggc
ccagtttctgggcagataatgcatgcagttggcgaagaaggaggatatgtcaaatatgta
tgcaaaattgaaaattatgatcagtctacccaagtgacctggtactttggtgtcagacag
ctggagaacagtgagaaatatgaaatcacctatgaagatggcgtggccaccatgtacgtc
aaacatattaccaaattcgatgacggcacctacagatgcaaagtagtcaatgactatggc
gaagacagttcttatgcagagctatttgttaaaggtgtgagagaagtttatgactattac
tgccgtagaactatgaagaaaattaagcgcagaactgatacgatgagactcctagaaagg
ccaccagaatttaccctgcctctctataacaagacagcttatgtgggtgaaaatgtccgg
tttggagtaaccataaccgtccacccagagcctcgtgtaacatggtataagtcaggtcag
aaaatcaaaccagatgatgatgacaagaagtacacctttgaatctgacaagggtctttac
caattaacaatcagcagtgtaactctagaagacgatgctgagtatactgttgtcgcaagg
aacaaatatggtgaagacagctgtaaagcaaagctgactgtaaccccacacccacctcca
acagatacaaccttaagacccatgttcaaacggctactggcaaacgcagaatgccaagaa
ggccaaagtgtctgcttcgagatcagagtgtctggcatccctgcaccaacgctaaaatgg
gagaaagacggtcagccgctgtcccttgggcccaacattgaaattatccacgaaggcttg
gactattatgctttgcacatcagggatactttgcctgaagacacaggttattatagggtc
acagccacaaacacagcaggatctaccagctgccaggctcacctacaagtggaacgcctg
aggtacgtcaaacatgaatacaagagcaaggaggagcgcgaacgacatgtacaaaggcaa
attgacaagacactaagaatggctgaaattctttctggaactgaaagtgtgccactgaca
caggtagcccaagaggctctgagagaagctgccatcctttacaaaccagctataagcacc
aagactgtaaaaggggaattccgacttgagacggaagaaaagaaggaggagagaaaactc
cgtatgccttatgaggtaccagagccacgcaagtacaagcagactaccatagaagaagac
caacacattaagcagtttgtgcctatgtctgacatgaaatggtacaaaaagatacgcgat
caatttgaaatgcctgggaaacttgacagagttgtacagaaaagacccaagcgcatccgc
ctttcaagatgggaacagttctacgtgatgcctcttccacgctttacagatcaatacaga
cccagatggcgtattcccaaactgtctcaagatgatcttgaaatggtgagaccagcacgc
cggcgtacaccttctcctgattattacttttattacagaccgagaagacgttctcttggt
gacatctcagatgaagaattactcttgcccattgatgactacttggcaatgaaaagaaca
gaagaagagaggttgcgtcttgaggaagagcttgaattaggtttctcagcttcaccccca
agccgaagccctccacgttttgagctatccagtctgcgttactcttcaccacaagctcat
gtcaggacggaggaaacaagaaaagacttcagatattcaacctatcacatcccagtgaag
gctgagactagtacaagttatgcggaactgcatgaacggcatgcccgggcctcctataga
cagccgaaacaacggcaaaggatcatggctgagaaggaggatgaagagttgcttcgtcca
gttactaccacccagcgtctctcagcatacaaaagcgagcttgaccacatatcaaaggaa
gaaaagtctagaaagaaatcaagacaacagagagaagtgacagaaataacagaaattgag
gaagaatacgaaatctcaaaacatgctcaaagagagacatcctcatctgtgtctagactg
ctgagacgacggcgctccctgtctccaacttacattgagttaatgaggccagtgtccgag
ctgatccggcgacgtccacagccggctgaggaatatgaagacgaatatgaagatgacaca
gaaagaaggtctcctactccagagagaactcgcccccgctcccccagccccgtgtccagt
gagaggtctctctcaagatttgagcggtctgcaagatttgatatcttttccaggtatgag
tccatgaaagctgctttaaagactcagaagacctcagaaaggaagtatgaagttttgact
cagcagccttttacgctggaccatgcccctcgaatcacattgagaatgcgctcccacagg
gtaccatgtggccaaaatacatgttttatcttaaacgttcagtctaagccaactgccgag
gttaaatggtaccataatggtgtagaactccaagagagcagtaagattcgttacaccaac
atgagtggggtactgaccctggaaattctggactgtcatattgatgacagtggaacatac
cgtgctgtgtgcaccaactacaaaggggaagcttctgactatgcgaccttggacgtaacg
ggaggggattacaccacctatgcttcccagcgcagagacgaagatgtcccccgatctgtt
ttccctgagctgacaagaatagaggcatatgcggtgtcttcatttaagaaaacatctgag
atggaagcttcttcttcagtcagggaaatgaaatcacagatgacagagacaagggaaagt
ctctcatcatatgaacaccatgcatctgcagaaatgaaaagcgctgcaatagaagaaaag
tcgctggaagaaaaatccacacacagaaagatcaagacaactttggcagcaagaattcta
accaagccaaggtccataactgtctatgaaggcgagtccgcaaggttttcttgtgataca
gatggtgagccagtaccaactgtgacctggctgcgtggaggacaagtgatcagtacttcc
gcccgccaccaagtgaccaccacaaagtacaaatcgacctttgagatctcttcagtccag
gcttccgacgagggcaactacagcgtggtggtggagaacagtgatgggaagcaagcagca
cagtttaccctgactattcaaaaggcccgggtgaccgaaaaggctgtgacagcaccacca
agagtcaaatccccagagcctcgggtgaaatctccagaaggagttaagtctccaaaacga
gtgaaatccccagaaccagtgacttctcacccaaaagctgtctcaccaacagagacaaaa
cccacagcaacagagaaactccagcagctccctgtctctgccccacccaggataactcag
tccctgaaagcagaagcttctaaagatattgcaaagctgacctgtgcagtcgaaagtagt
atattatctgcaaaagaggtcacctggtataaagatggcaagaaactgagggaaaatgga
catttccagtttcattattcggcagatggtacctatgagctcaaaatccataacctcact
gaatccgattgtggagaatacgtttgtgagatttctggtgaaggtggaagttccaaaact
aacttccagtttacgggacaagcctttaagagtatccatgagcaggtatcaagcatagca
gaaactaagaaatcagctcagaaaactgctgagtcaacagaaaccaagaaatcagttcag
aaaactgctgagtcgacagaaaccaagaaaacagctcagaaaaccactgagtcgacagaa
accaagaaaacagctcagaaaactgctgagtcaacagaaaccaagaaaactgagccaaaa
gctccggaaccaatttcctcgaaaccagtaattgttactgggctacaggatacaaccgtt
tcttcagatagcactgctaaatttgtagttaaggttaccggagaaccccggccaactgtc
atctggacaaaagatggaaaggctattacacaaggaggtaaatataaactctctgaagac
aaaggaggattcctcctagaaattcataagactgagacctctgacggcgggctttatact
tgcacaataacaaattcagccggctctgtgtcctcgagctgcaaattaacaataaaagct
gtaaaagacactgaggcgcagaaagtatccacacaaaagacctctgaaattacatcccag
gagaaggcagtagtccaggaagaaatttcccaaaaagccctaatttctcaagaaatcaag
aagtcagaggtgaaatctcaggaaaagttagccatgaaggaggaagcttcaaaggttctg
atttctgaaaaagtcaagaaatcagaagcagcttccctggataaatccattgtccatgag
gaaatctctaaaacatcacaggcatccgaagaaatcagaactcaggccgaggtgaaggca
ttctctactcagatgagcataaatgatggtcagaaagtgactttaaaagccaacattgct
ggagccactgatgtgaaatgggtactgaatggagtagagctaactaactccgaggagtac
agatacggtgtctcaggcagcgatcagaccctaaccatcaagcaggccggtcacaaagat
gcaggaatcctcacctgcatcggcaaaaccagccaaggaatcgtcaagtgtcagtatgat
ctgaccctgagcaaagaactctcagatgctccagccttcatctcacagcccagatctcaa
aacgttaacgaaggacaaaatgttctcttttcttgtgaaatcagtggcgagccatcccca
gaaatcgaatggtttaaaaacaacctcccgatttccatttcttcaaatatcagcgtaagt
cgctctagaaatgtatattctcttgaaatccgaaatgcatctgaaagcgacagtgggaag
tacacagttaaggccaaaaatttccgtggccagtgctcagctactgcttctctcacggtc
cttcctctagttgaagaaccttccagagaggtagtattgaggacaagtggtgacacgagc
ttgcacggaagcttctcgtctcagtcaatgcaaatgtcggcctctaagcaggaggcctcc
ttcagcagtttcagcagcagcagtgctagcagcatgactgaaatgaaatttgcaagcatg
tctgcccaaagcatgtcctccatgcaggagtcctttgtagaaatgagttccagcagtttt
atgggaaaagctagcatgacacaactggaaagctcaactagtagaatgcttaaagcaggc
ataagaggagttccacctaaaattgaagctcttccctctgacatcagcattgatgagggc
aaagttttaacagtagcctgtgcttttacgggtgagcctactccggaaataacgtggtcc
tgtcgtggaagaaaaattaaaaatcaagaacaacaagggagattccttattgaaaacaca
gatgacctgacaactctgatcatcatggacgtacagaaacaagatggtggaatttatacc
ctgagcttagggaatgaattcggatctgactctgccactgtgaatataaatattcgatcc
atttaa

DBGET integrated database retrieval system