KEGG   Equus caballus (horse): 100053844
Entry
100053844         CDS       T01058                                 
Symbol
TTN
Name
(RefSeq) titin isoform X1
  KO
K12567  titin [EC:2.7.11.1]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04820  Cytoskeleton in muscle cells
ecb05410  Hypertrophic cardiomyopathy
ecb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09140 Cellular Processes
  09142 Cell motility
   04820 Cytoskeleton in muscle cells
    100053844 (TTN)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100053844 (TTN)
   05414 Dilated cardiomyopathy
    100053844 (TTN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100053844 (TTN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100053844 (TTN)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ecb04812]
    100053844 (TTN)
   04147 Exosome [BR:ecb04147]
    100053844 (TTN)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100053844 (TTN)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   100053844 (TTN)
Membrane trafficking [BR:ecb04131]
 Others
  Actin-binding proteins
   Others
    100053844 (TTN)
Cytoskeleton proteins [BR:ecb04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     100053844 (TTN)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100053844 (TTN)
SSDB
Motif
Pfam: I-set fn3 Ig_3 ig Ig_2 Pur_ac_phosph_N V-set fn3_2 C2-set_2 Tissue_fac Receptor_2B4 Pkinase C1-set CRLF2-like_D2 Ig_6 PK_Tyr_Ser-Thr SusE Titin_Z Ig_5 Adeno_E3_CR1 Ig_4 NDNF THB PPAK Kelch_1
Other DBs
NCBI-GeneID: 100053844
NCBI-ProteinID: XP_023477838
Ensembl: ENSECAG00000012544
VGNC: 51493
Position
18:complement(56785112..57053971)
AA seq 33441 aa
MATQAPTFTQPLQSVVVLEGSTATFEAHVSGLPVPEVSWFRDGQAISTSTLPGVQISFSD
GRARLTIPAVTKANSGRYSLRATNGSGQATSTAELLVTAETAPPNFVQRLQSMTVRQGSQ
VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGELYSLLIAEAYPEDSGTYSVNATN
SVGRATSTAELLVQGEEVVPAKKTKTIVSTAQISETRQTRIEKKIEAHFDARSIATVEMV
VDGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPTPSP
VRSVSPAGRISTSPIRSVKSPLLVRKTQTSTLAQGPEVPPPWKQEGYVASSEAEMRETTV
TSATQIRTEERWEGRYGVQEEVTISGAAGAAASVSVSAAFAAGAVATGAAEVKQETDKSA
AVATVVAAVDMARVREPVISAVEQTAQRTTTTATHIQPAQEQIRKEAEKTAVTKVVVAAD
KAKEQELKRTREVITTKQEQVHVTHEQIRKETEKAFVPKVVISAAKAKEQETRITGEITK
KQEQKQITQETIMKETRKTVVPKVIVATPKVKEQDLVSRTREGITTKREQVEITQEKMRK
EAEKTALSTIAVATTKAKEQETILRTREAKATRQEQIQVTQEKVDVGKKAEAVATVVAAV
DQARVREPRAPAHLEESYAQQTTLEYGYKEHISATKVAEHPQRPASEPHVVPKAVKPRVI
QVPSETHVTTTDQMGMQISSQIKKTTDLTTERLVHVDKRPRTASPHFTVSKISVPKTDHG
YEASIAGTAIATLQKELSATSPAQKITKSVKAPTVKPAETRVRAEPTPSPQFPFADIPET
YKSQAGIEVKKEVGVSIAGATVREEHFEVLHGREVKVTEAARVPAPVEIPVTPPTLVSGL
KNVTVIEGESVTLECHISGYPSPKVTWYREDYQIESSIDFQITFQSGIARLMIREAFAED
SGRFTCSAVNEAGTVSTSCYLAVQASEEFEKETTAVAEKVTTEEKRFVESRDVVMTDTSI
TEEIAGPGEPAAPFFITKPVVQKLVEGGSIVFECQVGGNPKPHVYWKKSGVPLTSGYRYK
VSYNKQTGECRLVISMTFADDAGEYTIVIRNKHGETSASASLLEEAEYESLVKSQQEMLY
QTQMTAFVQEPKVGEIAPGFLYSEYEKEYEKEQALIRKKMAKDTVMVRTFVEDQEFHISS
FEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAIESGFELRVKNYRILEGMGVT
FHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNI
KGNAICSGKLYVEPAAPLGAPTYIPTPEPVSRIRSVSPRSVSRSPIRISPARMSPARMSP
ARMSPARMSPGRRLEETDESQLERLYKPVFVLKPASFKCLEGQTARFDLKVVGRPMPETF
WFHDGQQIVNDYTHKVVIKEDGTQSLIIVPAAPSDSGEWTVVAQNRAGRSSISVMLTVEA
VEHQVKPVFVEKLKNVNVKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGT
KGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERRLIIPRGTYRA
KEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPI
GDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYNRDSGVITCRATNKYGTDHTS
ATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLFPEP
VRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGE
VKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPKPEFHVHEPGKLQFEVQKVDRPVD
TTETKEVVRLKRAERITHEKVSEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEE
LLRKTKEELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTV
GQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASI
MVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYK
DGVEIHKGNKYRMHSDRKVHFLSVLTIDPSDAEDYSCVLVEDENVKTTAKLIVEGAVVEF
VKELEDIEVPESFSGELECIISPENIEGKWYHNGVELKSNGKYTITSRRGRQNLTVKDVT
KEDQGEYSFVADGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLENVEGVWM
KDGQEVQSSDRVFIVIDKQSHMLLIEDMTKEDAGNYSFTLPALGLSTSGRVSVYSVDVIT
PLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVHAIVKGTKQRLVINRTHA
SDEGPYKLMVGRVETSCDLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKG
KEIKPNAKYKIEAHGKIYKLTVLNMMKDDEGEYTFYAGENMTSGKLTVAGGAISKPLTDQ
TVAESQEAVFECEVANPDSEGEWLRDGKHLPLSKNIRSESDGHKRRLIIAASKLDDIGEY
TYKVATSKTSAKLKVEAVKIKKTLKNLTVTETQDAVFTVTLTHPNVKGVQWIRNGVVLES
NDKYDVSVKGTTYSLRIKNCAVSDESVYGFKLGRLGASARLHVETVKIIKKPRDVTALEN
ATVAFEVSVSHDTVPVKWFHKNVEIKPSDKHRLVSERKVHKLMLQHISPSDAGEYTAVVG
QLECKAKLFVETLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKI
VVQGKLHQLLIMNTSTEDAAEYTFVCGNDQVSATLKVTPIMITSMLKDINAEEKDTITFE
VTVNYEGISYKWLKNGVEIKSTDRCQMRTKKLTHSLNIRNVHFGDAAEYTFVAGKATSTA
TLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDGQELQIVDRIKIQKEK
YVHRLLIPSTRMSDAGQYTVVAGGNMSTANLFVEGRDVRIRSIKKEVQVIEKQRAVVEFE
VNEDDVDAHWYKDGIEINFQIQERHQYVVERRIHRMFISETRHSDAGEYTFVAGRNRSSV
TLYVNAPEPPQILQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLH
DGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIIT
PLQDTVTSEGQPARFQCSVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPE
DEGTYTFAASNAMGQVSSTANLRLEAHESLLHERIEEQIEVEMKAAPVLRRRIEPLEVAL
GHLAKFTCEIQSAPNVRFQWFKAGRQIYDSDKYSIRSSKYVSSLEILRSQVVDCGEYTCK
ASNEYGSVSCTATLTVTEAYPPTFYSRPKSVTTFVGKAAKFLCTVLGTPVIETVWQKDGA
ALSPSPNCKISDAENKHILELSNLTIQDQGVYSCKASNKFGADICQAELIIIDKPHFIKE
LEPVQSAINKKIHLECQVDEDRKVTVTWKKDGQKLPPGKDFKIYFEDKIASLEIPLAKVK
DSGTYVCTASNEAGSSSSSATVTIREPPSFVKKVEPSYLMLPGESARLHCKLKGSPVIQV
TWFKNNKELNESNTIRMSFVNSEAVLDITDVKVEDSGSYSCEAVNDVGSDSCSAEIVVKE
PPSFIKTLEPADIVRGSNALLQCEVAGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVSLE
IFAFNSADVGEYECVVANEVGKCGCLATHLLKEPPTFVKKVDDFTALAGQTVTLQAAVRG
SEPISVTWMKGQEVIKEDGKIKMSFSNGVAVLIIPDVQISFGDRYTCLAENEAGSQTSVG
ELIVKEPAKIIERAELIQVTAGDPATLEYTVTGTPELKPKWYKDGRPLIASKKYRISFKN
NVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVDSIVSGT
CRLDCKIAGSLPMRVSWFKDGKEIASSDRYRIAFVEGTASLEISRVDMNDAGNFTCRATN
SVGSKDSSGALIVQEPPSFVTKPASKDVLPNSAVCLKSTFQGSAPFTVRWFKGDKELVSG
GSCYITKEALESSLELYAVKTSDSGTYTCKISNVAGSVECSANLFVKEPATFVEKLELSQ
LLKKGDTAELACKVTGTPPIKITWFVNDREIKESSKHRMSFVESSAVLRLTDVATEDSGE
YMCEAQNEAGSDHCTGVLIVKEAPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITWFKD
NTTLRSGRKYKTLIQDQLVSLQILKFVAADAGEYQCRVTNEVGSSTCSARVTLREPPTFV
KRIESTSSLRGGTAAFQATLKGSLPITVTWLKDNDEITEDENIRMTFENNVASLYLSGIE
VKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEEAVSIDVTQGDPATLQVKFSGTKEIT
AKWFKGGQELTLGQKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCRASINVL
DLIIPPSFTKKLKKMDSIKGSSIDLECIVAGSHPISIQWFKDDQEISASEKYKYSFHDNT
AFLEISHLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQDVNPNTRVQLKA
LVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTVLELFSAKAADSGTYICQLSNDVGTV
TSKVTLFVKEPPQFIKKPSPVLVLRNGQSTTFECQITGTPEIRVSWYLDGNEITAIRKHG
ISFVDGLATFQISGARVENSGTYVCEARNDAGTASCSIQLKVKEPPTFIRELQPVEVVKD
SDVELECEVMGTSPFEVTWLKNNREIRSSKKYTLSDRVSVFYLHITKCDPSDTGEYQCII
SNEGGSCSCSARVSLKEPPSFIKKIENVTTVLKSSATFQSTVAGSPLISVTWLKDDQILD
EDDNVHISFVNNVATLQIRTVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQIIEKAKS
VDVTEKDPVTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMMQDSG
QYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSSVHMECKVSGSLPISAQ
WFKDGKEISTSAKYRLVCHENTVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEP
PSFLVKPERQQAIPDSTVEFKAVLKGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSFLNL
YSVDASKTGQYTCQVTNDVGSDSCTTLLFVTEPPKFVKKLEASKIVKAGDSARLECKITG
SPEIRVVWYRNEHELPASDKYRMTFIDSVAVIQMNNLGTEDSGDFICEAQNPAGSTSCST
KVIVKEPPVFSSFPPVVETLKNTEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKIVSKN
FHASIHILNVETSDIGEYHCKAQNEVGSDTCICTVQLKEPPRFVSKLNSLTVVAGEPAEL
QASIEGTQPIYVQWLKEKEEVIRESENIRITLVENIATLQIARAEPANAGKYICQIKNDG
GTRENMATLTVLEPAVIVEKAGSMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQK
HKFSFYNKISSLKILSVEKQDAGTYTFQVQNNVGKSSCTAVVDVSDRTVPPSFTRRLKDT
GGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGN
YTCVAANVAGSDECRAVLAVQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTSPFKVGWFRG
ARELVKGDRCNIYFEDTVAELELFNVDISQSGEYTCVVSNNAGQTFCTTRLYVKEPAAFV
KKLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITPSEKCNIVTTEKTCLLEILNST
KRDAGQYSCEIENEAGKDVCEALVSTLEPPYFVTELEPLEASVGDSVSLQCQVAGTPEIT
VSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNIHDSGEYTCKAENSIGTASSKTIFRIQ
ERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVSWYRDGVLLRDDENLQTSFVDNV
ATLKILQTDLSHSGQYSCSASNPLGTASSTARLTAREPKKSPFFDIKPVSIDVIAGESAD
FECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDV
GKDMCSAQLSVKEPPKFVKKLEASKVAKQGESTQLECKISGSPEIKVLWFRNDSELHESW
KYNMSFVNSVALLTINEASTEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSPVGA
LKGSDVVFQCEIAGTPPFEVVWVKDRKQVRSSKKFKITSKNFDTSLHILNLEASDVGEYH
CKASNEVGSDTCVCTVKFQEPPRFVKKLSDTSTLVGDAVELRAVVEGFQPISVVWLKDKG
EVIRESENTRISFIDNVATLQLGSPEASNSGKYVCQIKNDAGMRECSAVLTVLEPARIIE
KPEPMTVTTGNPFALECVVTGTPELSTKWFKDGRELSGDSKHHITFVNKVASLKIPCAEM
SDKGLYSFEVKNSVGKSNCTVSVHVSDRVVPPSFIRKLKDLNAILGSSAVLECRVAGSAP
ISVGWFQDGNEIISGPKCQSSFSENVCTLNLSSLEPSDTGVYTCVAANVAGSDECSAVLT
VQEPPSFEQTPDSVEVLPGVSLTFTSVFRGTPPFKVKWFKGSRELVSGDSCTISLEDYVS
ELELFEVEPLQSGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADFSVETGSPIVLEAT
FTGTPPISVSWMKNEFPLSQSQNCTITMTEKSTILEILDSTIEDYAQYSCLIENEAGQDI
CDALVSVLEPPYFIEPLEHVEATIGEPTTLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQ
FKNNVASLVINKVDHSDVGEYSCKAENSVGAVASSAVLVIKDRKLPPSFARKLKDVHETL
GFPVAFECRINGSEPLQVSWYKDGVLLKDDSNLQTSFVHNVATLQILQTNQSHVGQYNCS
ASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGSFKCHVTGTAPIKITWAKDN
REIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNVAGKDSCSAHLGVQEPPRFIK
KLEPSRIVKQDEYTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFLDSVAVLEMHSLS
VEDSGDYTCEARNAAGSASSSTSLKVKEPPIFRKKPHPVETLKGADVHLECELQGTPPFQ
VSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCAGSITLR
APPRFVKTLSDISTIVGEEVQLQTAIEGAEPISVVWFKDKGEVVRESDNIWISYSENIAT
LQFSRAEPANAGKYTCQVKNDAGMQECFATLSVLEPAAIVEKPESIQVTTGDTCTLECTV
TGTPELSTKWFKDGKELTSDSKYKISFFNKVSGLKIINVAPGDSGVYSFEVQNPVGKDSC
TASVRVSDRIVAPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQ
TTLTDNTCALTVNSLEESDAGDYTCVATNRAGSDECSAPLTVREPPSFVQKPDAMDVLTG
TNVTFTSIIKGTPPFMVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTMQSGEYTCIV
SNEAGKASCTTHLHVKAPAKFVKRLNDYSIEKGKHLILEGTYTGTPPISVTWKKNGINIA
PSQRCHITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQLEP
VKVTVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTATYKMHFKNNVATLVFNQVDVNDSG
EYICRAENSVGEVSSSTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFECAINGSEPISVS
WYKDGKPLKDGPNVQTSFLDNVATLNIFKTDRSLAGQYSCTATNPIGSASSSARLILTEG
KNPPFFDIPVAPVDAVVGESADFECHVTGTQPIKVGWAKDNREIRSGGNYQISFLENSAH
LTILKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKKLSETVEETEGNSFRL
EGRVAGSQPITVAWYKNNVEIHPTSNCEITFKNNTLLLQVKKAGMGDAGLYTCKVWNDAG
SALCTSSIVIKEPQKPPVFDQHLTPVTVSEGEFVQLSCHVRGSEPIRIQWLKAGREIKPS
DRCSFSFASGTAVLELKDVTKADSGDYVCKASNAAGSDTSKSKVTVKDKPAAVPAAKKAA
VDGKLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRIFIHQKGDE
AKLEIRDTTKTDSGLYRCVAFNKHGEIESNVNLQVDERKKQEKIEGDLRAMLKKTPVLKK
GAGEEEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQQEETHRLEIEEI
EKSEKEEKEFEELVSFIQQRLSQTEPVTLIKDIENQTVLKDNDAVFEIDIKINYPEIKLS
WYKGTEKLEPSDKFEISIDGDRHTLRVRNCQLKDQGNYRLVCGPHIASAKLTVIEPAWER
HLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRILKPQGRYKTEVEHKVHKLTIADVRAE
DQGQYTCKYEDLETSAELRIEAEPIQFTKRIQNIVVSEHQSATFECEVSFDDAIVTWYKG
PTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRGEARSTAELYLTTKEIK
LEMKPPDIPDSRVPIPTMPIRAVPPDEIPPTAIPPIPLLLPAPEEKKPPAKRVEVTKKAK
KVAKPKEEAPPPKVPEVAKKPPPPTALIPAKAPEIIDVSSKAEEVKIMTITRQKEVQKEK
EAVYEKKRAVYEEKKLFIESLEEPYDELEVEPYTEPYEEPYYEEPDEDYEETKVEARKEV
HEEWEEDFEAGQEYYEREEGYDEGEEEWEETYQEREAVQVQKEVYEEPHERKIPAKVPEK
KEAPPPKVVKKPVVEKIEKTSRRVEEAKVQVTKVPEVSKKIVPQKPSRTPVQEEVIEVKV
PAVHTEKMVISEEKFFASHTEEEVSVTVPKVQKKTVTEEKIQVAVSKKIEPPPKVPEPPR
KPAPEEVVPVPIPKKVEPPPAKVPEVPKKPVPEEKKPVPVPKKEPAAPPKVPEVPKKPVP
EEKVPVPVAKKKEAPPAKVAEVQKRVVTEEKVTIVTQREESPPPAVPEIPKKKVPEEKRP
VPRKEEEAPPPKVPAPPKKPVPEEKVPVPVPVPKKAPPPRAEVSKKAVVEEKRYFAEEKL
SVAVPQRTEVVRHEEEEWSYSEEQERVSISVYREEEREEEEAEVTEYEVMEEPEEYVVEE
ELHVIAERVEAEPAEVPEKKIVPKPKIPAKIEEPSPAKVPEPPKKIVPEKKLPAAVPKKE
KVPPAKVPEEPKKPVPEKRAPPKVAKIEEPVPTKVTERHMQITQEEKVLVAVTKKEEPPR
ARVPEEPKRAIPEEKVPKLKPKKEEEPPTKVAEIRKRAVKEEKVSIEVPKREPQFAKEVA
VAEEKEWSYTREEEVVSVQREEEYEEYEEEYDYKEFEEYEPTEEYEQYDEYEEREFEHYE
EYKEREEYVTEPEKPVPVKPVQEEPVPTKPKAPPVKVPKKAVPEEKVPVPIPKKLKPVPP
KVTEEAKKVVEEKIHISITKREKEQVTEPTAKVPLKLKRVVTEEKVPVPKKEVAAPVRVP
EVPKRREPEEIAFEEEVVTQVEEYHEEEEEYIYEEEELVTEEEVVPVIPVKVPEVPKKPV
PEEKKPVPVPKKKEAPPAKVPEIPKKPEEKVPVPIPKKEKAPPAKVPEVPKKPVPEEKVP
VPVPKKVEAPPAKVPEVPKKPVPEKKVPVPVPKKVEAPPAKVPEVPKKIIPEEKKPTPVP
KKVEAPPPKVPEVPKKVEERPIVVPEEEEVPPVEVFEEPEEPIPEEEIPEEPPTIEEEVE
EVAPPRVPEVVKKAVPEAPTPVPKKVEAPPAKVPKKVPEEKVPVPVQKKEAPPAKVPEVQ
KKVPEKKVPEKKIPEKKVPEKKVLVPKKEAVPPAKDALSGRTVEEKISVAFHKEEVVRER
TEFEIVEAEAVLEEEEFHEVEEYFEEEEFHEVEEFTKVEEHRFEEVHEVEEVRRVIEVLE
AEEVEVYEEPKAPPKVPEAPKEVVPEKKVPAPPPKKPEVPPVKVPEAPKEVVPEKKVPAA
PPKKPEVPPAKVPEVPKAAVPEKKVPEAIPPKPESPPPEVPEVPPKEVIPEKKVPVAPPK
KPEPPPAKVPEAPKEVVPEKKVPVPRPKKPEVPPVTVPEAPKEVVPEKKVSVAPPKKPEV
PPVTVPEAPKEVVPEKKVPVPLPKEPEVPPVKVPEPPKKVVPEKKVPVAPPKEPEVPPVT
VPEAPKEEIIPEKKVPVPPPKKSEVPPVKVPEAPKEVVPEKKVHVPPPKKPEVPPVKVPE
APKEVVPEKKVPAPPPKKPEVPPVKVPEAPKEVVPEKKVPAAPPKKPEVPPAKVPEVPKA
AVPEKKVPEAIPPKPESPPPEVYEEPEEVVPEEPPAEVVEEPEPAPPPKVTVPPKKPVPE
KKPPAVIAKKPEPPPVKVPEVPKEVVPEKKVPPVVPKKPEVPPAKVPEVPKEVVPEKKVA
VPKKPEVPPPKVPEVPKEPVVEEKPAVPIPEEVEPPPPEVYEEPEEIAPEEEEPVPVAEE
EPEAPPPAVPEEPEKIVPEKKVPVIKKPEAPPPKEPEPEKKVVEKPKLKPRPPAPAPAPP
KEDVKEKIAQLKAVSKKKVPEKPEVPEKVELKPLKVLGGEKKVRKLLPEPKPQPKEEVVL
KSVLRKKPEEEEPKVEPKKVEKVKKPAVPEPPPKPVEEVEAPPAAVTKREKKVPEPTKVP
EIKPPIPLPAPEPKPKPEPEVKIIKPPPVEPAPTPIAAPVTVPVVGKKAEAKAPKEEAAK
PKGPIKGVAKKTPSPIELEKKKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIVLTE
AESVGSSAIFECLVSPSTAITSWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEY
TCVLRLGNKEKTSTAKLIVEELPVRFVKTLEEEVTVVKGQPLYLSCELNKERDVVWRKDG
KIVVEKPGKIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWL
VKPIRDQHVKPKGTAVFTCHIAKDTPNIKWFKGYDEIPWEPNDKTEIVKDGNHLSLKIKN
ATPEDIDEYAVEIEGKRYPAKLTLGDREVELLKPIEDVTIYEKESASFDAEISEADIPGQ
WKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDF
AVPLKDVTVPEKRQARFECVLTREANVIWSKGPDIIKSSDKFDIITDGKKHILVINNSQF
DDEGVYTASVEGKTTSARLFVTGIRLKFISPLEDQTVKEGETATFVCELSHEKMHVVWFK
NDVKLHTSRTVLISSEGKTHKLEMREVTLDDISQIKAQVKDLSSTANLKVLEADPYFTVK
LHDKTGVEKDEIILKCEVSKDVPVKWFKDGEEIEPSPKYSIKSDGLRRILKIKKAELKDK
GEYVCDCGTDKTTANVNVEARLIKVEKPLRGVELFVGETARFEIELSEPDVHGQWKLKGE
PLTASPDCEIIEDGKKHILVLYNCQLDMTGEVSFQAANAKSAAKLKVKELPLIFITPLSD
VKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDKIELIKDGTKHSMVIKSAAFEDEAK
YIFEAEDKHTSGKLIIEGIRLKFLTPLKDVTAKERESAVFTVELSHDNIRVKWFKNDQRL
HTTKLVSMEDEGKIHSITFKNLSIDDTSQIKVEAMGMSSEAKLTVLEGDPYFTGKLQDYT
GVEKDEVVLQCEISKADAPVKWFKDGEEIKPSKNAIIKADGKKRMLILKKALKSDIGQYT
CDCGTDKTSGKLDIEDREIKLVRPLYSVEVMETETARFETEISEDDIHANWKLKGEALLQ
TPDCEIKEEGKTHFLILHNCRLDQAGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVT
AGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGRVHTLTLRDVKLEDAGEVQLT
AKDFKTQAKLFVKEPPVEFTKPLEDQTVEEEATAVLECEVSRENAKVKWFKNGTEILKSK
KYEIVADGRVRKLIIHGCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLRVKEK
EMARFECELSRENAKVHWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVR
TARTSGMLTVVEEEAVFTKNLTNVDVSETDTIKLVCEVSKPGAEVTWYKGDEEIIETGRY
EILTDGRKRILIIQNAHLEDTGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEK
AEFVCSISKESFEVQWKRDDKTLESGDKYDVIADGKKRILVVKDATLQDMGTYVVMVGAA
RAAAHLTVIEKLRIIVPLKDTRVKEQQEVIFNCEVNTEGAKAKWFRNDEAIFDSSKYIIL
QKDLVYTLRIRDARLDDQANYSVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEK
KSVTFWCKVNRLNVTLKWTKNGEEVAFDNRVLYRIDKYKHSLIIKDCGFPDEGEYIVTAG
QDKSVAELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKY
KFEKDGSVHRLIIKDCRLDDECEYACGVDDRKSRARLFVEEIPVEIIRPPQDILEAPGTD
VVFWAELNKDKVEVQWLKNNMIIVQGDKHQMMSEGKIHRLQICDIRPRDQGEYRFIAKDK
EARAKLELAAAPKIKTADQDLVVDVGQPLTMVVPYDAYPKAEAEWFKENEALSSKTVDTT
AEKTSFRILEAKKGDKGRYKIVLQNKHGKAEAFINLQVIDVPGPVRNLEVTETLDGEVSL
AWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDRADSCEFTVTGLQKGGVEYLFRVSARN
RVGTGEPVETANPVEARSRYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYIIE
LRDKTSIRWDTAMTVKAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADP
IERPSPPVNLSSSDQTQSSVQLTWEPPLKDGGSPILGYIIERCEEGKDEWIRCNKKLVPE
LTYKVTGLQKGNKYLYRVSAENEAGVSDPSEILGPLTADDAFAEPTMDLSSFKDGLEVIV
PNPIKILVPSTGYPRPTATWAFGDKVLEAGDRVKMKTLSAYAELVISPSERPDKGIYTLK
LENRVKAISGEIDVNVIARPSAPKELKFDDITRDSVHLTWEPPDDDGGSPLTGYLVEKRE
VNRKTWTKVIDSVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSAPATVP
DPPENVKWRDRTAKSIFLTWDPPKYDGGSRIKGYIVEKCPRGSDRWVACGEPVAETKMEV
TGLDEGQWYSYRVKALNRQGASKPSKPTDEIQAVDAQEAPEIFLDVKLLAGLTVKAGTKI
ELPATVTGKPEPTITWTKADTLLRQDKRITIENVPKKSTVTIVDSKRSDTGRYIIEAVNV
CGRATAVAEVNVLDKPGPPAAFDITEVTNESCLLTWNPPRDDGGSKITNYVVERRAADSD
MWHKLSSTVKDTKFKATNLIPNKEYLFRVAAENMYGVGEPVQATPITAKYQFDPPGPPTR
LEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLT
NKKKYRFRVLAENLAGPGKPSRSTEPILIKDPIDPPWPPGKPTVKDIGKTSIMLNWTKPE
HDGGAKIESYVIEMLKTGTEDWVRVAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEP
SEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRK
GWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYCEVEDSVLAKDTFTTPGPPY
ALTVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKEKLGTRWVKAGKTSGPDCNFRVTDV
IEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPP
EKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAVGV
SEPSEISENVVAKDPDCKPTIDLETHDIVVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVK
ASDRLTMKSDHISAHLEVPKSVHADAGVYTITLENKLGSATGSINVKVIGLPGPCKDIKA
SDVTKSSCKLTWEPPEYDGGSPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGE
YFFRVKAVNKIGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGG
SKIMGYIIEKIAKGEERWKRCNEHLVPVLTYTAKGLEEGKEYQFRVRAENAAGISEPSRA
TPPTKAVDPIDAPKVILRSSLEVRRGDEIALDATISGSPYPTITWIKDEEIITPEEIKKR
VAPMVRRRRGEVQEEEPFVLSLTERLSIDNSKKGESQLRVRDSIRPDHGQYMIKAENDHG
IAKAPCTVSVLDTPGPPINFVFEDVRKNSVVCKWEPPLDDGGSEIINYTLEKKDKTKPDS
EWIVVTSTLRHCKYPVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLIAKDPFEPPDAPDK
PIVEDVTSNSMLVTWNEPKDNGSPILGYWLEKREVNSTHWSRVNRNLLNSLKTNVEGLLE
GLTYVFRVCAENAAGPGKFSPPSDPKTARDPIAPPGPPVPRVADTSSTTIELEWEPPAFN
GGGEIIGYFVDKQLVGTNEWSRCTEKMIKARQYTVREIREGADYKLRVSAVNAAGEGPPG
ETEPVTVAEPKEPPTVELDVSVKAGIQIMAGKTLRIPAVVTGRPVPTKVWTIEEGELDKD
RVVIENVGTKSELIIKNALRKDHGRYVITATNSCGSKFAATRVEVFDVPGPVLDLKPVVT
NRKMCLLNWSDPEDDGGSDITGFIIERKDAKMHTWRQPIETDRSKCDITGLLEGQEYMFR
VIAKNKFGCGPPVEIGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRNNGGSPIQG
YIIEKRRHDKPDFERVNTRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVI
QDDEVPPTIKLRLAVRGDTIKVKAGEPVNIPADVTGLPMPKIEWSKNETVIEKPTDALKI
TKEEVSRSEAKTELSIPKAVRADKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTD
IKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKSEWEEVTNTAVEKRYGIWKLIPNGQ
YEFRVRAVNKYGISDDCKSDKVVIQDPYRPPGPPGKPKVLERTKGSMLVSWTPPLDNGGS
PITGYWLEKREEGGAYWSRVSRAPITKTGLKGVEFNVPRLIEGVKYQFRAMAINAAGVGP
PSEPSDPAVAGDPIYPPGPPSCPEVKDKTKSSISLAWKPPAKDGGSPIKGYIVEMQEEGT
TDWKKVNEPDKLLTTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDILEVP
EVFIDIGAQDCLICKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKALKDGVHDIPEDAQLE
TAENSSVIIIPECKRSHSGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSC
RLSWKMPDDDGGDRIKGYVIEKKTIDGKAWTKVNPNCGSTTFVIPDLISEQQYFFRVRAE
NRFGIGAPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIV
ECLAWDPTGKKKEAWKQCNKRDVEELEFTVEDLVEGGEYEFRVKAVNAAGVSKPSETVGP
VIVKDQTCPPSIELKEFMEVEEGTDVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVVYDT
HVNKVVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFES
ISADQMTISWLPPKDDGGSKITNYVIEKREPNRKTWVHVTSEPTECMYTIPKLLEGHEYV
FRIMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPV
TGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASL
PSDPVTARDPIAPPGPPFPKVTDWTKSTADLEWSPPLKDGGSRVTGYIVEYKEEGKEEWE
KAKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDAIEMKDRLVLPDVQLDA
SVRDRIVVHAGGVIRIIAYVSGKPPPTITWNMNERALPQEANIETTAISSSMVIKNCQRS
HQGVYSLLAKNAAGERKKTIIVDVLDVPGPVGIPFLPHNLTNDSCKLTWFSPEDDGGSPI
TNYVIEKREADRKAWTPVTCTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETTEEL
VIRDPITVPERPEDLEVKEVTKDSVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTS
DNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLDLDFRDKL
TIRVGEAFALTGRYSGKPKPKVTWFKDEADVLEDDRTQIKTTPTTLALEKIKAKRSDSGK
YCVVVENSTGSRKGFCQVNVVDRPGPPVGPVIFDEVTKDHMIISWKPPLDDGGSEITNYI
IEKKEVGKDVWMPVTSACAKTTCKVPKLLEGKDYIFRIHAENLYGISDPLVSDSMKAKDR
FRVPDAPDQPIVTEVTKDSALVTWNKPNDGGKPITNYILEKRETMTKRWVRVTKEPIHPY
TKFRVPDLLEGCYYEFRVSAENEIGIGDPSPPSKPVCAKDPIAKPSPPVNPEAIDTTCNS
VDLTWQPPRHDGGSKILGYIVEYQKVGDEEWKRANHTPESCPETKYKVTGLRDGQSYKFR
IRAVNEAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIRVGDTLRLSAVIKGVPFP
KVTWKKEDREAPTKARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLD
KPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVVTNYVVERRDVASAQWSPLSTTSKKKSH
LAKHLNEGSQYLFRVAAENQYGRGPFVETPKPIKAVDPLHPPGPPKNLHHVDVDKNEVSL
VWNKPDRDGGSPITGYLVEYQEEGTEDWIKFKTVTNLECVVTGLQQGKTYKFRVKAENIV
GLSLPDTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDG
SEIKTDDHYTVETDSYSSVLTIKNCLRKDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPT
GPINILEVTPEHMTISWQPPKDDGGSPVINYIVEKKDTRKDTWGVVSSGSSKTKLKVPHL
QKGFEYVFRVRAENKMGVGPPLDSVPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPK
SDGGSPITGYYVERREITGKWVRVNKTPITELKYTVTGLYDGNTYEFRVFAENLAGLSSP
SPSSDPIKACRPIKPPGPPINPKLKDKTRETADLVWTKPLSDGGSPILGYVVECQKPGTA
QWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEV
ELDVTCRDVITVRVGQTIRILARVKGRPEPDITWSKEGKALVREKRVDIIHDLPRAELQI
KEAIRADHGKYIISAKNSSGHAQGSTIVNVLDRPGPCQNLRVSNVTKENCTIAWENPLDN
GGSEITNFIVEYRKPNEKGWSIVASDVTKRLIKANLLANNEYYFRVCAENKVGVGPTIET
KTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSADWE
RVHKGSIKETHYMVDKCVENQIYEFRVQTKNEGGESDWVKTEEVVVKEDLQKPVLELKLS
GVLTVKAGDTIRLEAGVRGKPFPEVLWTKDKDATDLTRSPRVKIDTSADSSRFSLTKAKR
SDGGKYVITATNTAGSFVAYATVNVLDKPGPVRNLKITDVSSDRCTICWDPPEDDGGCEI
QNYILEKCESKRMVWSTYSATVLTTGATVTRLIEGNEYIFRVRAENKIGTGPPTESKPVI
AKTKYDRPGRPDPPEVTKVSKEEMTVVWTPPEYDGGKSITGYFLEKKEKHGTRWVPVNKS
AIPERRLKVQNLLPGHEYQFRVKAENEIGIGEPSLPSKPVVAKDPIEPPGPPTNLKVVDT
TKSSITLAWGKPVYDGGAPIIGYVVEMRPKRPDMSPDEGWKRCNAAAQLVRMEFTVTSLD
ENQEYEFRVCAQNQVGIGRPAELKDAIKPKEILEPPEIDLDASMRKLVTVRAGCPIRLFA
IIRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKA
VFVNVRVLDTPGPVSDLKVSDVTKTSCHISWGPPENDGGSQVTHYIVEKREADRKTWSTV
TPEVKKTSFQVTNLVPGNEYFFRVTAVNEYGPGVPTDVPKPVLASDPLCEPDPPRKLEVT
EMTKNSAALAWLPPLRDGGAKIDGYIISYREEEQPADRWTEYSVVKDLSLVVTGLKEGKK
YKFRVVARNAVGVSLPRETEGVYEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHP
TCKWKKGEDEVVTSSHLAVHKADNSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVIV
MDAPGPPQPPFDISDIDADACTLSWHIPLEDGGSSITNYIVEKCDVSRGDWVTALASVTK
TSCRVGKLIPGQEYIFRVRAENRFGISEPLTSPKMLAKFPFGVPSEPKNARVTKVNKDCI
FVAWDRPDSDGGSPITGYLIERKERNSLLWVKANDTPVRSTEYPCAGLVEGLEYSFRIYA
LNKAGSSPPSKPTEYVTARMPVDPPGKPEVIDVTKNTVSLIWARPKHDGGSKIIGYFVEA
CKLPGDKWVRCNTTPHQIPQEEYTVTGLEENAQYQFRAIAKTAVNISQPSEPSDPVTIVA
ENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKEGTLLQPAEGIKMAMKR
NLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLS
WEPPLEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKY
GVGDPIFTEPAVAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLVEKRE
TQAVNWTKVNRKPVIERTIKATGLQEGTEYEFRVTAINKAGPGKPSDASKAVYAQDPLYP
PGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQKLQKTR
FEVTGLLENTEYQFRVYAVNKVGYSDPSDVPDKHCPKDILIPPEGELDADLRKTLILRAG
VTMRLYVPVKGRPPPKITWSKPNVNLRERIGLDIKSTDFDTFLRCENVNKYDAGKYILTL
ENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYITWDPPIIDGGSPIINYVVEKRDA
ERKSWSTVTTECSKTSFRVSNLEEGKSYFFRVFAENEYGIGDPGETRDAVKASETPGPVV
DLKVTSVTKSSCSIGWKKPRSDGGSRIIGYVVDFLTEENKWQRVMKSASLQYSTKDLTEG
KEYTFRVSAENENGEGTPSEITAVAKDDVVAPDLDLKDLPDLCYLAKENSNFRLKIPIKG
KPAPSVSWKKGEDPLATDTRVSVESSAVNTTLVVYDCQKSDAGKYTITLKNVAGTKEGTL
SIKVVGKPGIPTGPIKFEEVTAEAITLKWGPPKDDGGSEITNYILEKRDSVNNKWVTCAS
AVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVAKHPFDVPDAPPPPNIVDVR
HDSVSLTWTDPRKTGGSPITGYHIEFKERNSLLWKRANKTPIRMKDFKVTGLTEGLEYEF
RVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINVTRNSVTLIWTEPKYDGGHKLTGY
IVEKRDLPSKSWTKANHVNVPDCAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTGTII
CKDEYEAPTIVLDPTIKDGLTIKAGDTIILSAISILGKPLPKSSWSRAGKDIRPSDIVQI
SSTPTSSMLTVKYATRKDAGEYTITATNPFGTKEEHVKVIVLDVPGPPGPIEISNVSAEK
ATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVAEDIQSCRHVATKLIQGNEYIFRVSA
VNQYGKGEPVQSEPVKMVDRFGPPGPPGKPEISNVTKNTATVSWKRPTDDGGSEITGYHV
ERREKKSLRWVRATKTPVSDLRCKVTGLQEGNTYEFRVSAENKAGVGPPSDASNPVLMKD
VAYPPGPPSNARVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTAL
RITEFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAPDFELDAELRRTLVV
RAGLSIRIFVPIKGRPAPEVTWTKDDINLKNRANIENTESFTLLIIPECNRYDTGKFVMT
IENPAGKKSGFVNVRVLDTPGPVLNLKPTDITKDSVTLHWDLPLIDGGSRITNYIVEKRE
ATRKSYSTVTTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKASEAPSPP
DSLNIMDITKSTVSLAWPKPKHDGGSRITGYVIEAQRKGSDQWTHITTVKGLECVVRNLT
EGEEYTFQVMAVNSAGRSAPRESRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIP
VLGRPKPTVTWKKGDQILKQTQRVNFENTATSTILNINECVRSDSGPYPLTAKNIVGEVG
DVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVE
LATTVIRTTYKATRLTTGMEYQFRVKAQNRYGVGPGITSASIVANYPFKVPGPPGTPQVT
AVTKDSITISWHEPLSDGGSPILGYHIERKERNGILWETVSKALVPGNIFKSSGLTDGIA
YEFRVIAENMAGKSKPSKPSEPAFALDPIDPPGKPVPLNITRHTVTLKWAKPEYTGGFKI
TSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSD
AITCRDDIEAPRIMVDVKFKDTVILKAGEAFKLEADVSGRPPPTMTWTKDGKELEGTAKL
EIKIADFSTNLVNKDSSRRDGGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVSEVT
SEKCVLSWLPPLDDGGAKIEHYVVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFR
VMAVNKYGVGEPLESEPVLAVDPFGRPDPPKNPEVTAITKDSMVVCWGHPDSDGGSEIIN
YIVERRDKAGQRWVKCNKRTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYK
ACDTVYKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWKIVTPP
AGLKATSYTITNLTENQEYKIRIYAMNSEGIGEPALVPGTPKAEERMLPPEIELDADLRK
VVTIRACCTLRLFVPIKGRPAPEVKWTREHGESLDKASIESTSSYTLLIVGNVNRFDSGK
YILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWEPPLLDGGSKIKNYIV
EKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASER
PLPPGKITLVDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDKWVTCATVKVTEATI
TGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVD
VPFIGRPTPAVTWHKDDVPLKQTTRVNAESTENNSLLTIKEACREDVGHYTVKLTNSAGE
ATETLNIIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTVW
QIVSATVARTTIKASRLKTGCEYQFRIAAENRYGKSTYLTSEPIVAQYPFKVPGPPGTPF
VTLSSKDSMEVQWNEPVSDGGSKVIGYHLERKERNSILWVKLNKTPIPHTRFKTTGLDEG
IEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIMVTRNSVTLQWKKPTYDGGS
KITGYVVEKKELPDGRWMKASFTNVIDTQFEVTGLVEDHRYEFRVIARNAAGVFSEPSES
TGAITARDEVDPPRISMDPKYKDTIVVHAGELFRIDADIYGKPIPTIQWIKGDQELSNTA
RLEIKSTDFATSLSVKDAVRIDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISG
VTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEGNEYT
FRIMAVNKYGVGEPLESEPVMAKNPFVVPDAPKAPEITTVTKDSMIVVWERPASDGGSEI
LGYVLEKRDKEGVRWTRCHKRLIGELRLRVTGLLENHNYEFRVSAENAAGLSEPSPPSAY
QKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCT
PPTGINKTNIEVEKLLEKHEYNFRICAVNKAGVGEHADVPGPVIVEEKLEAPDIDLDLEL
RKIINIRAGGSLRLFVPIKGRPTPEVKWGKMDGEIRDAAIIDVTSSFTSLVLDNVNRYDS
GKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNY
IVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEFGIGLPAHTADPVKVA
EVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKSLEA
VITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVRPAFHSYSVQVGQDLK
IEVPISGRPKPTVTWTKDDLPLKQTTRINVTDSLDLTVLSIKETHKDDGGHYGITVANVV
GQKTASIEIITLDKPDPPKGPVKFDEVSSESITLSWNPPLYTGGCQITNYIVQKRDTTTT
VWDTVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGT
PFVTTTSKDSMVVQWHEPINNGGSPVIGYHLEKKERNSILWTKVNKSIIHDTQFKAVNLE
EGIEYEFRVYAENIVGVGKVSKNSECYVARDPCDPPGTPEAIMVKRNEITLQWTKPAYDG
GSMITGYIVEKRDLPEGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGTISKPS
DSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEE
SARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQV
TGVTSEKCNLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKITKLLEGNE
YIFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNTAKDSMTVCWNRPDSDGGS
EIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPAT
VYYKACDPVFKPGPPINAHVVDTTKNSITLTWGKPIYDGGSEILGYVVEICKADEEEWQI
VTPQTGLKATRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDS
ELRKGIVVRAGGSARIHIPFKGRPTPDITWSREEGEFTDKVQIEKGVNYTQLSIDNCDRN
DAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVKKDSVILVWEPPMIDGGAKVK
NYVIDKRESTRKAYANVSNKCSKTSLKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVK
AAEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRILGYVVEMQPKGTEKWSVVAESKVC
NAVITGLSSGQEYHFRVKAYNEKGRSDPRVLGVPVIAKDLTIPPSFKLPFNTYSVQAGED
LKIEIPVIGRPRPEISWVKDGEPLKQTTRVNVEETANSTILHIKETNKDDFGKYTITATN
IAGTATENLSIIVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTT
TTTWQTVSATVARTTIKIAKLKTGTEYQFRIFAENRYGKSTHLDSKPVIVQYPFKEPGPP
GTPFVTSVSKDQMLVQWHEPVNDGGSKVIGYHLEQKEKNSILWIKLNKTPIPDTKFKTTG
LDEGIEYEFRVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNNVTLKWKKPAY
DGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSE
PSESTGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDIVWLKDGKEL
EETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGP
LKVSGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNYKVTKLLP
GNEYIFRVMAVNKYGVGEPLESEPVIARNPYKPPGPPSPPEVSAITKDSMVVTWARPVDD
GGAEIEGYILEKRDKEGVRWTKCNKKTLTDLRFRVTGLTEGHSYEFRVAAENAAGVGEPS
EPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWNKPIYDGGAPVKGYVVEVKEATADE
WTTSTPPTGLQGKQFTVTNLKENTEYNFRICAINSEGVGEPATIPGSVVAKDRLEPPEIE
LDADLRKMVILRASATLRLFVTIKGRPEPEVKWEKAEGILTERAQIEVTSSYTMLVIDNV
TRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLSVKDVKKDSVTLSWEPPLIDGGA
KVTNYIVEKRETTRKAYATVTNNCTKTTFKIENLQEGCSYYFRVLACNEYGIGLPAETSE
PVKASEPPLPPGRVTLVDVTSNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQV
KTLEATISGLTSGEEYIFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFHTFNVKA
RDQLKIDVPYKGRPQATVSWKKDGQTLRETTRVNVSSSKTITSLSIKEASREDVGTYELS
VSNSAGSITVPITVIVLDRPGPPGPIHIDEVSCDNITISWNPPEYDGGCQISNYIVEKRE
TTSTTWHVVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSTYSDSPAVVAEYPFSPPG
PPGTPKVVHATKSTMIVTWQVPVNDGGSQVIGYHLEYKERSSILWSKANKILIADTQMKV
SGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKP
HYDGGAKITGYIIERRELPDGRWLKCNFTNVQETYFEVTELTEDQRYEFRVFAKNAADSV
SEPSESTGPITVKDDVEAPRIMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGV
EIEERARTEIVSTDYNTLLTVKDCVRRDTGQYILTLKNVAGTRSVAVNCKVLDKPGPPAG
PLEIYGLTAEKCSLSWGPPQENGGADIDYYIVEKRETSRLAWTICEGELRTTSCKVTKLL
KGNEYIFRVTGVNKYGVGEPLESVAVKALDPFTVPSPPTSLEITSVTKDSMTLCWSRPES
DGGSEISGYIIERREKNSVRWVRVNKRPVYDLRVKSTGLREGCEYEYQVYAENAAGLSLP
SEASPLIRAEDPVFLPSPPAKPKIVDSGKTNITISWVKPLFDGGAPVTGYTVEYKTSDET
DWKTAIQNLRGTEYTISGLTTGAEYVFRVRSINKVGASDPSDSSDPQIAKEREEEPVFDL
DSEMKKTLIVKAGASFTVTVPFRGRPVPNVSWSKPDTDLRTRAYIDSTDSRTSLTIENAN
RNDSGKYTLTIQNILSAASLTLVVKVLDSPGPPANISVHDVTKESAVLSWDVPENDGGAP
VKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGQNEFGVGVPAETKDG
VKITEKPSPPEKLGVTSVSKDSVSLTWLKPEHDGGSRIVHYIVEALEKGHKNWFKCAVVK
STHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSQTVYV
RAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVAADAGRYE
ITAANSSGTTKTFINIIVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYIVL
KRETSTAVWTEVSATVARTTIKVMKLTRGEEYQFRIKAENRFGISDHIDSACVVVKLPYT
TPGPPSTPWVTNVTQESITVSWHEPVSNGGSAVIGYHLEMKDRNSILWQKVNKMIIRTTH
FKVTTISAGLIYEFRVYAENAAGVGKPSHASEPVLAIDACEPPRNIRITDISKNSVSLSW
QQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVIETQFIVSGLTQNSQYEFRVFARNAI
GSISNPSEVVGPVTCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPEPTIEWFK
DDKELQTNALLCVENTTDLASILIKDANRLNSGRYELKLRNAMGSASATIRVQILDKPGP
PGGPIEFKTVTAEKITLLWRPPVDDGGAKITHYVVEKRETSRVVWSMVSENLEECIITTT
KIIKGNEYVFRVRAVNKYGIGDPLESDPVVAKNAFVTPGPPSIPEVTKITKNSMTVVWNR
PVADGGSEISGYFLEKRDKKSLGWFKVLKESIRDTRQKVAGLTENSDYQYRVCAVNAAGQ
GPFSEPSDFYKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVAMRQG
EEEEWTVVSTKGEVRTTEYVVSNLKPGVNYYFQVSAVNCAGQGEPIEMTEPVQAKDILEE
PEIDLDVALRTSIIAKAGEDVHVFIPFKGRPPPTVTWRKDEKNLGSDARYSIQNTDSSSL
LIIPQVTRNDTGKYILTIENGVGQPKSSTVSVKVLDTPAACQKLQIKHVSQGTVTLFWDP
PLIDGGSPIINYIIEKRDATKRTWSSVSHKCSSTTFKVKDLSEKTPFFFRVLAENEIGIG
EPCETTEPVKAAEVPAPIRDLSVKDSTKTSVTLSWTKPDFDGGSVITEYVVERKGKGEQT
WSYAGISKTCEIEVGQLKELSELEFRVSAKNEKGLSDAVTIGPVTVKELVITPEVDLSEI
PGAQVAVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEYVRFSKTENKITLSIKNVKK
ENGGKYTVILDNAVCRTSVPITIITLGPPSKPKGPVRFDEIKADSVIMSWDVPDDDGGGE
ITCYSIEKREASQKNWKMVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSTII
VAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGAEVTGFHVEKKERNSILWQRINT
SPISGREYRATGLMEGLDYQFRVYAENSAGLSAPSDPSKFTLAVSPVDPPGTPDYIDVTR
ETITLKWNPPLRDGGSKIVAYSIEKRQGSDRWVRCNFTDVSECQYTVTGLSPGDRFEFRI
IARNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLTIKSGESLRIKALVQGRPVP
RVTWFRDGVEIEKKMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNVSGTAKAEIKVKV
QDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDNCET
LSYTAVKLITGNEYQFRISAVNKFGVGRPLDSDPVVAQIQYTIPDAPGTPEPTNVTGNSI
TLTWARPESDGGNEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVM
AENDAGVGPPSGISRLIKCREPVNPPSAPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGY
IIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKA
VDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWTKPDSNLSIRADIHTTE
SFSTLTVENCNRNDAGKYTLTVENNSGSKSVTFTVKVLDSPGPPGPITFKDVTRGSVTLM
WDAPLLDGGARIHHYVVEKREASRRSWQVVSEKCIRQILKVNDLVEGVPYYFRVSAENEY
GVGEPYEMPEPMVATEQPAPPKRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKG
SDFWVEAGHTKQLTFTVERLVENTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTAD
LTGITNQLITCKAGSTFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLSVK
DSMRGDSGRYFLTLENTAGVKTFTITVVVIGRPGPVTGPIEVSSVSAESCVLSWAEPKDD
GGTDITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLE
SAPIIAEHPFVPPSAPTRPEVYYVSANAMSIRWEEPYHDGGSKVIGYWVEKKERNTILWV
KENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPMMAQNPVDAPGRPEVT
DVTRSTVSLIWSSPVYDGGSKIVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSE
GDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLQGDLVTIRAGSDLVLD
AAVGGKPEPKIIWTKGDKELDLCEKISLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGT
KAVSVLVKVLDSPGPCGKLTVSRVTEEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWV
IVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSQPGMPEE
VGAGKEHIIIQWVKPESDGGNDISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTGLMEG
CDYQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYD
GGVDITGYVLEMQEKGTDQWYRVHTNATIRNTEFTVLDLKMGQKYSFRVAAVNVKGMSEY
SESTAEIEPVERLEIPDLELADDLKKTVTLRAGASLRLMVSVSGRPPPVITWSKKGIDLA
SRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKE
VSRDSVTITWEIPTIDGGAPVNNYIIEKREAAMRAFKTVTTKCSKTLYRISGLVEGCMYY
FRVLPENIYGIGEPCETSDAVLVSEVPLVPTKLEVVDVTKSTVSLAWEKPLYDGGSRLTG
YVLEACKAGTERWMKVATLKPTVLEHTVISLNEGEQYLFRVRAQNEKGVSEPREIVTAVT
VQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESDRVTVE
THTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIEATS
VTISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRQTFKFTRLTEGNEYVFRVAA
TNRFGIGSYLQSEVIECRSSISIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIV
ERKEVRADRWVRVNKVPVTMTRYRSTGLIEGLEYEHRVTAINARGTGKPSRPSKPIVAMD
PIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTK
IREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFV
RQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTELVIKEADRDDSGTYDLV
LENKCGKKAVYIKVRVIGNPNTPEGPLEYDDIQARSVRVSWRPPADDGGADILGYILERR
EVPKSAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVIPKTPLNP
PEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERRETSTDKWVRHNKTQITTTM
YTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVT
LQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKDRIKDRQFTIGGLLEATEYEFRVFAE
NETGLSRPRRTAMSVKTKLTSGEAPGVRKELKDVTTKLGEAAQLSCQIVGRPLPDIKWYR
FGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCMATNEVGEVETSSKLLLQATPQF
HPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAITWFHGQKLLQNSENITIENTEHYTHLVM
KNVQRKTHAGKYKVQLSNIFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSVVISWKPPA
DDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISD
PLEVPSVVIIKSPFEKPSAPSKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQ
NKWIAVTTDEIRETVFSVQNLIEGLEYEFRVKCENLGGESEWSEISEPVTPKSDVPIQAP
HFKEELRNLHVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLI
IAAVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIK
IPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFG
IDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERW
IRVGQARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRAMNYDEEV
DETREVSMTKASHSSTKELYEKYMIAEDLGRGQFGIVHRCVETSSKKTYMAKFVKVKGTD
QVLVKKEISILNIARHRNILYLHESFESMEELVMIFEFISGLDIFERINTSAFELNEREI
VSYVRQVCEALEFLHSHNIGHFDIRPDNIIYQTRRSSVIKIIEFGQARQLKPGDNFRLLF
TAPEYYAPEVHHHDLVSTATDMWSLGTLVYVLLSGTNPFLAETNQQIIENIMNAEFTFDE
EAFREISLEAMDFVDRLLVKERKSRMTASEALQHPWLKQKTEKVSTKVIRTLKHRRYYHT
LIKKDLNMVVSAARISCGGAIRSQKGVSVAKVKVASIEIGPVSGQIMHAVGEEGGYVKYV
CKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVATMYVKHITKFDDGTYRCKVVNDYG
EDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVR
FGVTITVHPEPRVTWYKSGQKIKPDDDDKKYTFESDKGLYQLTISSVTLEDDAEYTVVAR
NKYGEDSCKAKLTVTPHPPPTDTTLRPMFKRLLANAECQEGQSVCFEIRVSGIPAPTLKW
EKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERL
RYVKHEYKSKEERERHVQRQIDKTLRMAEILSGTESVPLTQVAQEALREAAILYKPAIST
KTVKGEFRLETEEKKEERKLRMPYEVPEPRKYKQTTIEEDQHIKQFVPMSDMKWYKKIRD
QFEMPGKLDRVVQKRPKRIRLSRWEQFYVMPLPRFTDQYRPRWRIPKLSQDDLEMVRPAR
RRTPSPDYYFYYRPRRRSLGDISDEELLLPIDDYLAMKRTEEERLRLEEELELGFSASPP
SRSPPRFELSSLRYSSPQAHVRTEETRKDFRYSTYHIPVKAETSTSYAELHERHARASYR
QPKQRQRIMAEKEDEELLRPVTTTQRLSAYKSELDHISKEEKSRKKSRQQREVTEITEIE
EEYEISKHAQRETSSSVSRLLRRRRSLSPTYIELMRPVSELIRRRPQPAEEYEDEYEDDT
ERRSPTPERTRPRSPSPVSSERSLSRFERSARFDIFSRYESMKAALKTQKTSERKYEVLT
QQPFTLDHAPRITLRMRSHRVPCGQNTCFILNVQSKPTAEVKWYHNGVELQESSKIRYTN
MSGVLTLEILDCHIDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASQRRDEDVPRSV
FPELTRIEAYAVSSFKKTSEMEASSSVREMKSQMTETRESLSSYEHHASAEMKSAAIEEK
SLEEKSTHRKIKTTLAARILTKPRSITVYEGESARFSCDTDGEPVPTVTWLRGGQVISTS
ARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSDGKQAAQFTLTIQKARVTEKAVTAPP
RVKSPEPRVKSPEGVKSPKRVKSPEPVTSHPKAVSPTETKPTATEKLQQLPVSAPPRITQ
SLKAEASKDIAKLTCAVESSILSAKEVTWYKDGKKLRENGHFQFHYSADGTYELKIHNLT
ESDCGEYVCEISGEGGSSKTNFQFTGQAFKSIHEQVSSIAETKKSAQKTAESTETKKSVQ
KTAESTETKKTAQKTTESTETKKTAQKTAESTETKKTEPKAPEPISSKPVIVTGLQDTTV
SSDSTAKFVVKVTGEPRPTVIWTKDGKAITQGGKYKLSEDKGGFLLEIHKTETSDGGLYT
CTITNSAGSVSSSCKLTIKAVKDTEAQKVSTQKTSEITSQEKAVVQEEISQKALISQEIK
KSEVKSQEKLAMKEEASKVLISEKVKKSEAASLDKSIVHEEISKTSQASEEIRTQAEVKA
FSTQMSINDGQKVTLKANIAGATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQAGHKD
AGILTCIGKTSQGIVKCQYDLTLSKELSDAPAFISQPRSQNVNEGQNVLFSCEISGEPSP
EIEWFKNNLPISISSNISVSRSRNVYSLEIRNASESDSGKYTVKAKNFRGQCSATASLTV
LPLVEEPSREVVLRTSGDTSLHGSFSSQSMQMSASKQEASFSSFSSSSASSMTEMKFASM
SAQSMSSMQESFVEMSSSSFMGKASMTQLESSTSRMLKAGIRGVPPKIEALPSDISIDEG
KVLTVACAFTGEPTPEITWSCRGRKIKNQEQQGRFLIENTDDLTTLIIMDVQKQDGGIYT
LSLGNEFGSDSATVNINIRSI
NT seq 100326 nt   +upstreamnt  +downstreamnt
atggcaactcaagcaccgacgtttacgcagccgttacagagcgttgtggtactggagggt
agtaccgcaaccttcgaggctcacgttagtggtttgccagttcctgaggtgagctggttt
agggatggccaggcaatttccacttccactctgcccggcgtgcagatctcctttagcgat
ggccgcgctagactgacgatccccgccgtgactaaagccaacagtggacgatactccctg
agagccaccaatggatctggacaagcgactagtactgctgagcttctcgtgacagccgag
acagcgccacccaacttcgttcaacggctgcagagcatgactgtgagacaaggaagccaa
gtgcgactccaagtgagagtgactggaatccctacacctgtggtgaagttctaccgggac
ggagccgaaatccagagctcccttgatttccaaatttcacaagaaggcgaactctacagc
ttactgattgcggaagcatacccggaagactccgggacctattcagtaaatgccaccaac
agcgttggaagagctacttcgactgccgaattgctggttcaaggtgaagaagtagtaccc
gctaaaaagacaaagacaattgtttcgactgctcagatttcagaaacaagacaaacccgg
attgaaaagaagattgaagcccactttgatgccagatcaatcgcaacagttgagatggtc
gtagatgggcaacagctgccacataaaacacctcccaggatacctccgaagccaaagtca
aggtctcccacaccaccatccattgctgccaaagcacagttggctcgacagcagtcccca
tcgccgataagacactcgccttccccggtcagacatgtgcgagcaccgaccccatctccg
gtcaggtccgtgtctccagctgggaggatctccacgtcgcccatcagatctgtgaagtcg
ccattgctcgtccgtaagactcagacctccaccctggcccaaggccctgaagtgcctcct
ccttggaagcaagagggctatgtggcctcatctgaggctgagatgagagaaacgacggtg
acaagcgcgactcagatcaggacagaggagagatgggaagggagatacggagtccaggag
gaagtgaccatcagcggagctgcgggcgccgctgccagcgtgtcggtcagcgctgccttc
gcggcaggtgctgtcgccacgggtgctgcagaggtgaaacaagaaactgacaaaagcgca
gctgttgcgaccgttgttgctgctgttgatatggccagagtgagagaaccagttatcagt
gctgtagagcagactgctcagaggacaaccacgactgccacgcacatccaacctgctcaa
gaacagataagaaaggaggcagagaagactgctgtaactaaggtagtagtggccgccgat
aaagcgaaggaacaagaattaaaaagaaccagagaagtaattacgacaaaacaagagcag
gtgcacgtaactcacgaacagataagaaaagaaactgaaaaagcatttgtaccaaaagta
gtaatttctgcagctaaagccaaagaacaagaaactagaattactggagaaattactaaa
aaacaagaacaaaaacaaataactcaagaaacgataatgaaagaaactaggaaaacagtg
gtacctaaagtcatagttgccacacccaaagtgaaagaacaagatttagtatcaagaact
agagaaggcatcactaccaaaagagagcaagttgaaataactcaggaaaagatgagaaag
gaagctgagaaaactgccttgtctacaatagcagttgcaactactaaagccaaagaacaa
gaaacaatactgagaactagagaagcaaaggctactagacaagaacaaatccaagttacc
caagaaaaggtggacgttgggaaaaaggctgaagctgtagcaacagttgttgctgcagta
gaccaggcccgtgttagagagcccagagcacccgcgcatcttgaagaatcgtatgctcag
cagactactttggaatatggatacaaggagcacatttctgccacaaaggtagctgagcat
ccccagcgtccggcctcagaaccccacgttgtccctaaagcagtcaagcctagagtaatc
caggttccttctgagactcatgtcacaactactgatcaaatgggaatgcagatatcatca
cagatcaagaaaactacagatctaacaactgaaagattagtccatgtggataaacgcccc
cgcacagcaagccctcactttaccgtttcaaagatttctgttcctaagacagatcatgga
tatgaggcatcaatagcaggcactgctattgccacattacaaaaagagttgtcagccaca
tctcctgctcagaagatcaccaaatcggtgaaggcacccacggtgaagcctgctgagacc
agagtgagagcagagcccaccccctcacctcagttcccctttgctgacataccagagact
tacaagagtcaagctggcattgaagtgaaaaaggaagtaggggtgagcatcgctggtgcc
accgtccgtgaagagcactttgaagtactgcacggacgtgaagtcaaggtaacagaagca
gcaagagtgcctgcacctgttgaaattcctgttactccaccaactttggtctcgggctta
aaaaatgtgactgtcatagaaggtgaatctgtcaccttggagtgccatatatctggatac
ccatccccaaaagtgacgtggtacagagaagactaccaaatagaaagttccattgacttc
cagataaccttccagagcggaattgctcgtctgatgatccgagaagcctttgcagaagac
agcgggcggtttacttgcagtgctgtgaacgaggctgggaccgtcagcacatcctgctat
ctagctgtgcaggcatcagaagagtttgaaaaggaaacaacagctgtggctgagaaagtt
accacagaagagaaacgctttgtggaatcaagagatgtggtaatgactgataccagcatc
acagaggaaatagcaggacccggagaacctgccgctcctttctttattacaaaaccagtg
gtccagaaactggtggaaggtgggagcattgtgtttgaatgccaagttggcggcaaccca
aagccccatgtctactggaaaaaatctggggttcctctaaccagtggatacagatacaaa
gtgagttacaataaacaaaccggtgagtgcagactggtgatttcgatgacttttgctgat
gatgctggagaatacacgattgttattcgtaacaagcatggagaaacttctgcatctgcc
tccttgctcgaagaagctgaatatgagtcactggtgaagtcccagcaagaaatgctttac
cagacacaaatgactgcattcgtgcaagaacctaaagttggagaaatagcacctggattt
ctatactctgagtatgaaaaagaatatgaaaaagaacaggccttaattaggaagaaaatg
gccaaagatactgtaatggtcagaacttttgtagaagaccaggaattccacatttcttcc
tttgaagagagactcattaaagaaattgaatacagaataataaagactacattagaagaa
cttcttgaagaagatggagaagaaaaaatggcagtggacatttctgaatctgaagccatt
gaatcaggatttgaattacgagtcaagaattatagaattcttgaggggatgggtgttaca
tttcattgcaagatgtctgggtatccgctacccaagattgcatggtacaaagatggcaag
cgcatcaaacatggagagagataccaaatggactttctacaagacggcagagccagtctg
cgcatacccgttgttcttccagaagatgaaggcatctatactgcatttgccagcaatatt
aaaggaaatgcgatttgctcagggaaattgtatgtggagcctgctgcaccacttggtgct
ccgacttacatacccacaccagagccagtgagcagaatcagatctgtctctccacgttca
gtgagcagatctcctatacgcatatctcctgcacggatgtcccctgcaaggatgtctcct
gcacggatgtcccctgcaagaatgtcccccggacgtaggctggaggaaacagatgagtca
caacttgagagactgtataagccagtcttcgtgttaaaacctgcttctttcaaatgttta
gaaggacaaactgccagatttgacttgaaggttgtgggtagacctatgccagagaccttc
tggtttcatgatggccagcaaattgtcaatgactacacccataaagtagtcattaaagaa
gatggcacccaatcactgattattgtccctgcagcacccagtgattctggggaatggact
gtggttgcccaaaacagggcaggcagatcttcaatttcagtaatgttaactgtggaagct
gtggaacatcaggtaaaaccagtgtttgtggaaaaactgaaaaatgtcaatgtaaaggaa
ggttctcgacttgaaatgaaagtcagagctacgggtaatcccaaccctgacattgtatgg
ttgaaaaacagtgacatcattgtacctcataaatatccaaaaatcagaattgaaggaacc
aagggagaagcggcccttaaaatcgattctactgtcagccaagattctgcctggtatact
gccactgctattaataaagctggccgagacactacaagatgcaaagtcaatgttgaagtt
gagtttgcagagcccgaaccggaaagaagattaatcatcccaagaggaacatacagagca
aaggagattgcagcccctgaactggagcccctccatttgcgatatggtcaagaacaatgg
gaagagggtgacctctatgacaaagagaaacaacagaagccatttttcaagaaaaaactc
acttccttaagactcaagcgcttcgggcctgcccactttgaatgcaggctaacaccaatt
ggtgacccaacgatggtggtagaatggcttcatgatggaaagccacttgaagcagccaat
aggcttcgtatgatcaatgaatttgggtattgcagccttgattacggagttgcatataat
agggacagtggtgtcattacttgcagagccactaacaaatatggaacagatcacacatct
gctacccttattgttaaagatgagaaaagtcttgtggaagaatctcaattgcctgagggg
aggaaaggcttacagagaattgaagaattagagaggatggctcatgaaggtgcacttaca
ggtgtaacaacagatcagaaagagaagcaaaagccggatatcgtcttgttcccagagcca
gtaagagtacttgaaggggagaccgctagattccgttgccgagtgacaggttaccctcag
cccaaagtcaactggtacctcaatggacagctcatccgcaaaagcaaaaggttcagagtt
cgctatgatggcattcattatctggacatcgtggactgcaaatcatatgatacaggtgaa
gtcaaggtcactgcagaaaatcctgaaggtgtgatagagcataaagtgaaacttgagatc
caacagagggaagatttcaggtctgtccttaggcgagctcctgaaccaaagcctgagttt
cacgtacatgaacctggaaaacttcagtttgaagtacaaaaggtagatagacctgttgac
accacagaaaccaaggaagttgtgaggttgaagagggctgaaagaattacccatgaaaaa
gtgtctgaagagtcagaagagctgcgcagtaagttcaagcgcagaacagaggagggatat
tacgaagccattactgctgtagagcttaagtctcgaaagaaggatgaatcctatgaagaa
ctcctgaggaagacaaaagaggaacttctccactggaccaaagagttaaccgaagaggag
aagaaagcccttgccgaggaaggcaaaatcactattccaacttttaaacctgataaaatt
gaactaagtcctagtatggaggctcctaaaatctttgaaagaatccaaagccaaacagtg
gggcaaggatctgatgctcacttccgggtcagagttgtgggaaaaccagatcctgaatgc
gaatggtacaaaaatggtgtcaaaatcgagcgctctgaccgaatctactggtactggcct
gaagacaatgtttgtgaactggtcataagagatgtgactgctgaggactctgccagcatc
atggtcaaagccatcaacatagctggggaaacctcaagccacgcattcttactcgtccaa
gccaagcaattgatcactttcacacaggaattacaagatgttgttgctaaggaaaaagac
accatggcaacctttgaatgtgaaacttcagagccatttgttaaagtgaaatggtataaa
gatggtgtggagattcataagggaaataaatataggatgcactctgacaggaaagttcac
ttcctctctgtgttgacaatcgacccctctgacgctgaagactacagctgtgtacttgtg
gaagatgaaaatgtaaaaacaacggctaaactgattgtcgaaggtgcagttgttgaattt
gtgaaagaacttgaggacatagaagttccagaatccttttcgggagagttagagtgcatt
atatccccagaaaatatagaaggcaaatggtatcacaatggcgtggagcttaaatccaat
ggcaaatacacaattacatctcgccgtggacgtcagaacctcacggtcaaggatgtaacc
aaagaggaccagggagaatacagctttgttgccgatgggaaaaagacaacctgtaaacta
aagatgaaaccccgccccattgctattctacaaggtcttagtgatcaaaaagtctgcgag
ggtgacatcgttcagcttgaagttaaagtctccttagagaatgtagaaggcgtctggatg
aaagatggccaagaagtgcagtccagtgacagggttttcattgtgatagacaaacagtca
cacatgctgctcattgaagacatgaccaaggaggatgctggaaattactccttcaccctt
ccagccctgggactgtcaaccagtgggcgcgtctctgtctatagtgtggatgtgataaca
cctctaaaggatgttaacgtgattgagggtaccaaggctgtgctcgaatgtaaagtttca
gtccctgatgtgacttctgttaaatggtacttaaatgatgaacaaatcaagcctgatgat
cgagtacacgccattgtcaagggcactaagcagcgactagtgattaaccgcacccatgct
tcagatgaagggccttacaagctgatggttggccgagttgaaaccagctgtgatctctct
gtagaaaaaattaaaattatcagaggtcttcgtgaccttacctgtacagaaacccaaaat
gtggtctttgaggttgagctgtcccactcaggaattgatgtcttgtggaattttaagggc
aaggaaatcaaacccaatgctaaatataaaattgaagctcatgggaaaatatataagttg
acggttttaaatatgatgaaagatgatgaaggagaatacacattttatgctggagaaaat
atgacatctggaaaacttaccgtggcagggggcgccatctccaagcctctcacagatcag
accgtagccgagtcccaggaagctgtctttgaatgcgaagttgccaacccagattccgag
ggcgaatggctaagggatggcaaacacctgcctctgagtaaaaacatcagaagtgagtct
gatggccacaaaaggagacttatcatcgctgccagcaaattggatgacattggagaatac
acctacaaggtggccacctccaaaacatctgccaaactcaaagttgaagctgtcaaaatt
aagaagactctgaagaatctcacagtaacggagacgcaggatgctgttttcactgtcaca
cttacacatccaaatgtaaaaggtgtccagtggatcagaaatggggttgtgctggaatcc
aatgacaagtacgatgtctcagtcaaaggaacaacttactctctgagaattaaaaactgt
gctgtttcggatgaatctgtttatggcttcaagctcggaaggctaggagccagtgccaga
ctgcacgttgagactgtcaagatcattaaaaagccaagggatgtgaccgccttggaaaat
gccaccgttgcctttgaagttagtgtttcccatgacacagttccagtaaaatggttccat
aagaatgtggagattaagccgagtgacaaacacagactggtctcggaaaggaaggtccac
aagctgatgctgcagcatatttccccgtcagatgctggggagtatacagctgtggtgggg
caattggaatgcaaagctaagctgtttgtggagacattacatattacaaaaaccatgaaa
aacatcgaggtgcctgagaccaaaactgcctcctttgagtgtgaggtgtcccacttcaac
gtcccttccatgtggctgaagaatggggtggagattgagatgagtgaaaagttcaagata
gtcgtgcagggaaaactccaccagctgctcatcatgaacaccagcacagaggacgcagca
gaatacacgtttgtctgcggcaacgaccaagtcagcgccaccttgaaagtgaccccaatc
atgattacatccatgctgaaggacatcaatgctgaagaaaaagacacaattacctttgag
gtgacagtgaactatgaaggcatctcttacaaatggttaaagaacggtgtggaaatcaaa
tccactgacaggtgccagatgagaaccaaaaagctcacacactcattgaacatcaggaat
gttcactttggagatgctgctgagtacacctttgtggctggaaaagctacgtcgacagcc
acactttatgtggaagctcgtcatatagagtttaggaaacacattaaggacattaaggtt
ctcgagaagaagagagccatgtttgaatgtgaagtctctgaacctgacatcactgtgcag
tggatgaaggacggtcaagaactgcagattgtggacagaataaagatacaaaaggagaaa
tatgtccaccgccttctgatcccatccacccggatgtccgatgctgggcagtacacagtg
gtggcaggaggcaacatgtccaccgctaacctctttgtcgagggcagagatgttcgcatc
cgaagtattaaaaaggaggttcaggttattgagaaacaacgtgctgtcgttgagtttgag
gtcaatgaagatgatgttgatgcccactggtataaagatggaattgaaatcaatttccaa
atccaagaacgacatcaatatgtggtggagagaagaatccaccgaatgttcatctctgag
accaggcacagtgatgccggtgaatacacctttgtggcaggaaggaacaggagttctgtt
actctttatgtcaatgctccggaaccaccccaaattctgcaggagctccagcctgttact
gtgcaatctggcaagcctgcccgcttctgtgctgtgatatccggcagaccgcagcccaaa
atttcttggtacaaggaagagcagctgctttccactggcttcaagtgcaaatttcttcac
gatgggcaagagtacacgcttttgctaatcgaagccttcccagaggacgcggctgtctac
acctgtgaagccaagaatgactatggagttgcgacgacctcagcttcactctcagtggaa
gttccagaagttgtgtctcctgatcaggaaatgccagtttatcctcctgccatcatcacc
ccgcttcaggacactgtcacttctgagggacagccagcccgttttcaatgcagcgtttct
ggaacagatctcaaagtgtcttggtacagcaaagacaagaaaatcaagccatctcggttc
tttagaatgactcagtttgaagacacttaccagttggagattgctgaagcttatccagaa
gatgaagggacttacacttttgctgctagtaatgccatgggtcaagtatcgagcacagcc
aacttgagactggaagcccatgaatcgcttttacatgagaggattgaagaacagattgag
gtggagatgaaagctgctccagtgctcaggaggagaattgagccccttgaagtggctctg
ggccatctagccaagttcacctgtgagatccagagtgcccccaatgtgcggttccagtgg
tttaaggctggccgacaaatttacgacagtgacaagtattctatccgatcttcaaagtat
gtctccagcctggaaatcctgagatcccaggttgttgactgcggcgagtacacctgcaaa
gcttccaatgagtatggcagtgtcagctgtacagccacactgaccgtgacagaggcatat
ccaccaaccttttactccagacctaaatccgttacaacttttgtgggtaaggcagccaag
ttcctctgcacagtgctaggaactcctgtgattgaaaccgtttggcagaaagatggcgcc
gcgctatcaccttctcctaactgcaagatttcagatgcagaaaacaaacacattttagaa
ctctcaaatcttacaatacaagaccaaggagtttactcttgtaaggcttccaacaagttt
ggagccgacatctgccaagctgagttgatcataatcgacaaaccgcatttcattaaagaa
ttagagcctgtgcaatcggctatcaataagaagatccaccttgagtgccaagtagatgaa
gacagaaaagtcacagttacatggaagaaggatggtcaaaaactgccccccgggaaagat
tttaagatctattttgaagataaaatagcatcacttgagatccctctggccaaagtaaaa
gattcaggaacctatgtttgcacagcttccaatgaggcaggcagcagctcctcttcagca
acggtaaccatcagagagccaccatcctttgtgaagaaggtagagccctcttatttaatg
ctccctggtgaatcagcccgcctccattgcaagctgaaaggctcacctgtgatccaggtt
acttggtttaaaaataacaaagaacttaatgagagtaacacaatccgaatgtcttttgtc
aattctgaggctgtacttgatattacggatgtgaaagttgaagacagcgggagttactcc
tgtgaagccgtgaatgacgtgggcagtgacagctgcagtgctgaaatagttgtcaaagaa
cctccttctttcatcaaaactctcgagcctgcagatatagtgagaggatcaaatgccctc
cttcagtgtgaagtcgcaggcactggaccatttgaaattagctggttcaaagataagaag
caaattcgaagtagtaaaaagtacaggttgttttctcagaagtctcttgtgtctctggag
atctttgcttttaacagtgccgatgttggtgaatatgaatgtgtcgttgctaatgaagtt
gggaagtgtggctgccttgcaacacacttattaaaagaaccaccaacctttgtaaagaaa
gtagatgattttaccgcactagcaggacagactgttaccttacaagctgctgtgagaggg
tcagaacccatttctgtcacatggatgaaaggacaagaggtcattaaagaagatggaaaa
atcaaaatgagcttttccaatggtgttgccgtcttgataatccccgatgttcagattagt
tttggtgacagatacacatgcctggctgaaaacgaagccggaagccaaacgtctgtaggg
gaattaatagttaaagaacctgccaaaatcattgagagagcagagctgatccaggtgaca
gcgggggacccagccacactggagtatacagtcacaggcaccccagaactcaagcccaaa
tggtacaaagatgggagacctttgattgctagtaaaaagtatcgaataagttttaaaaac
aatgttgcccaactcaaattttattcggctgaactgcatgatagtggccaatacacattt
gagatttccaatgaagtgggcagcagctcctgcgagacaactttcactgtattagatcga
gacattgctccgttttttaccaaacccctacgcaacgtggatagcattgttagtggtacc
tgcaggctggactgcaaaatcgctggctccctccccatgagggtatcttggtttaaggat
ggcaaagaaatagcttcttctgacagatacagaatagcatttgtggaaggcacggcctct
ttggagataagcagagtagacatgaatgacgcggggaatttcacttgtcgagccacaaat
tctgtgggaagcaaagacagcagcggagccctgattgtgcaagaaccacccagttttgta
accaaacccgcatcaaaggatgttctgcccaactctgcagtctgcctgaagagcaccttc
caggggtctgctcctttcacagtcagatggtttaagggtgacaaagagctggtttctggt
ggaagctgctatattaccaaagaagctttagaaagttccctggaactctatgcagtaaaa
acctctgattcaggcacatacacctgtaaaatcagcaatgtcgctggaagcgtggagtgc
agtgcaaacttatttgtaaaagaacctgccacctttgttgagaagttagagctatcacag
ctattaaagaaaggagacaccgccgagctagcctgcaaagtaactggtacccctccaatt
aaaataacatggtttgtgaatgatagagaaattaaggaaagcagcaagcacagaatgtct
tttgtggaatccagtgcggtcctaagactcacagatgttgccactgaagacagtggcgaa
tacatgtgtgaggctcaaaatgaggctggcagtgaccactgcacaggcgttttaatagtc
aaagaggcaccttactttaccaaggaatttaagccaatcgaagtgttgaaggagtacgat
gtcatgttgctggccgaggtggcaggcactcctccctttgagatcacttggttcaaagac
aacacaacgctgcgaagtggtagaaagtataaaaccttgattcaggatcagctggttagc
ctgcagatcctcaagtttgtagccgcagatgctggcgaataccagtgtcgggtgaccaac
gaggtgggcagcagcacctgcagtgccagggtgactttaagagaacccccaacctttgta
aagaggatcgagagcaccagctctcttcgaggaggcacagctgccttccaggcaactctg
aagggctccttgccaatcacggtgacttggttaaaagacaatgatgaaatcactgaagat
gaaaatataagaatgacctttgagaacaatgtggccagtctgtacctcagtggcattgaa
gtcaagcatgatggcaaatatgtctgtcaggccaaaaatgatgcaggaatacaaagatgt
tctgcattactctcagtaaaagaacctgcaacaatcaccgaggaggctgtgtctatagat
gtcacccaaggagacccagccaccttgcaggttaaattttcagggactaaggagattaca
gccaaatggtttaaaggtggccaagaactgaccctgggccaaaaatataaaatcagtgtc
actgacacagtctctatactgaagattatttctactgaaaagaaagatagtggagaatac
acttttgaggtccaaaatgacgttgggagaagcagctgcagggctagcattaatgtatta
gatcttattatacctccctcattcaccaaaaagctgaagaaaatggacagcattaaaggg
tcttctattgatttagaatgtatagtcgctgggtcacatcccataagcatccaatggttc
aaagatgaccaagaaatatcagctagtgaaaaatacaaatactcttttcatgacaatact
gccttcttggagatcagtcacctggaaggtacagacagtgggacatacacttgttctgcc
actaataaggcaggacacaaccagtgcagtggccatctgacagtcaaagaacccccttac
ttcgtagaaaagcctcagtcacaagatgtcaatcccaacacaagggttcagttaaaggct
cttgtgggtggcactgcgcccatgacaataaagtggtttaaagacaacaaagagttgcac
tcaggagcagctcgctcagtttggaaggatgacacctccaccgttctcgagctcttttca
gccaaagctgccgactctgggacctacatttgccaactaagcaatgatgttggcacagtg
accagtaaagtcactctctttgtgaaagaacctcctcaattcattaagaagcccagccca
gtcttggtgctgaggaatggacaatctacaacattcgaatgccaaataacaggcactcct
gaaatcagagtttcttggtatctggacgggaatgaaataacagccattcggaaacatggc
atttccttcgttgatggtttagccactttccaaatttctggtgccagggtagaaaatagt
gggacttacgtctgtgaagctcgtaatgacgcaggcacagcaagctgcagcattcaatta
aaagtgaaagaacctcccacctttatcagggagctgcagccagtggaagtagtgaaagac
agtgacgtggagctggagtgtgaagtgatgggaacatctccatttgaagtcacttggctg
aagaataatagggaaattcgaagcagcaaaaaatataccctgagtgacagagtatcagtg
ttttacctccatataaccaagtgtgacccttcagacactggtgaataccagtgcataata
tccaatgaaggtggcagctgctcatgcagtgctagagtctccttgaaagagccaccatca
ttcattaagaagatagaaaatgtcactactgttttgaaaagttctgccacatttcagagc
accgtggcaggctctcctctcatttctgtaacctggctgaaagatgatcagattcttgat
gaagacgataatgttcatatttcatttgtgaacaatgtggccacacttcagatcagaact
gtggataatggacacagcgggagatacacgtgtcaagccaagaacgagtcaggagttgag
aggtgttatgctttccttttagtacaagaacctgctcagatcatagagaaagctaaatct
gttgatgtcaccgagaaagacccagtgaccttggagtgtgttgtggcgggaacaccagaa
ctcaaagtgaaatggcttaaagatgggaaacaaattgtgcccagtagatacttttcgatg
agttttgaaaataacgtggccagcttcaggattcagtcagtaatgatgcaagacagtggt
cagtatactttcaaggtggaaaatgactttggaagcagtagctgtgatgcctacctgcgt
gtgctagatcaaaatattcctccatcattcaccaaaaaattaaccaaaatggataaagtt
ctgggctcttctgttcatatggagtgcaaggtttctggctcacttcctattagtgctcag
tggtttaaggatggaaaagaaatatctacaagtgcaaaatacagacttgtctgtcacgag
aacactgtgtcactggaagttaataatctggaattagaagatactgcgaattacacatgc
aaggtctcaaatgtagcaggggatgacgcatgcagcggcatcttaactgtgaaagaaccg
ccaagcttcctggtgaaacctgagcgacaacaagccatacctgattctacagtggaattc
aaagcagtactgaaaggaacaccaccatttaaaatcaagtggtttaaggatgatgtggaa
cttgtctctggacctaaatgcttcattggcttggaagggtcaactagcttcttaaatctc
tattcagtggatgcttccaagactggacaatatacttgccaagttaccaatgatgttggt
agcgactcttgtactacacttttgttcgtgacagaaccaccaaagtttgtaaagaaatta
gaagcatccaaaatagtgaaagcaggtgactcagcacgacttgaatgcaagataactgga
tccccagaaataagagttgtgtggtacagaaatgagcatgaactcccagccagtgataaa
tacagaatgactttcattgactcagttgccgtcattcagatgaacaatctcgggactgaa
gacagtggggatttcatttgtgaggctcagaatcctgctggcagcacaagctgcagtacc
aaggttatagtaaaagaaccacctgtttttagcagcttccctcctgtagtagaaaccctt
aaaaatactgaagttagtcttgaatgtgaactttcgggaacaccaccatttgaggtggta
tggtacaaagacaagcggcaactcagaagtagcaagaaatacaagatcgtgtccaaaaac
ttccatgcaagtatccacattctcaatgtggaaacttcagacatcggtgaatatcactgc
aaggcacagaatgaagtgggaagtgatacttgcatttgtactgtacaactgaaagaacca
ccaagatttgtgtccaaactgaacagcctcaccgttgtagctggtgagcccgccgagttg
caagcgtccatagaaggcacccagcctatttatgtccagtggcttaaagagaaggaagaa
gtgattagagaaagtgaaaacatcagaattacacttgtggaaaatattgcaactctgcag
attgcaagagcagaaccagctaatgctgggaagtatatctgccaaatcaagaatgatggc
ggaacgagggagaacatggccacattgactgttctagagcccgcagtcattgtcgagaaa
gcaggatcaatgacagtgactgtaggagaaacgtgcactctggagtgtaaggtggctggc
actcccgaactctcagttgaatggtacaaggatggaaagctgttgacaagcagccaaaaa
cacaaatttagcttctacaacaaaatctcttccttaaagattctctctgttgaaaagcaa
gatgcaggcacatacactttccaggttcaaaataatgttggaaaaagcagctgcacagct
gtggtggatgtctcagaccgaacggttcctccttctttcacacgaagactgaaagatact
ggtggggttctgggtgcttcttgcatcttggagtgtaaagtagctggatcatcacctatc
tctgttgcctggtttcatgagaaaactaagattgtcagtggagcaaagtaccaaaccacg
ttttcagataatgtctgcacgttgcagctgaattccctggactcatcagatatgggcaat
tacacatgcgtggctgctaacgtagctgggtctgatgaatgtcgtgcagtgttggctgta
caagaaccaccctcttttgtgaaggaacctgaacctttggaagtactaccaggcaagaat
gtcaccttcacaagtgttattagaggaacctctcccttcaaggttggctggttcagaggt
gccagagaactggtgaaaggagacaggtgcaacatctattttgaagacactgtggcagag
ctggaattatttaatgtcgacatatctcagagtggggaatatacctgtgtggtttctaac
aatgctggccaaacattctgcactactcgtctctatgtaaaagaaccagctgcatttgtg
aagaagttaagcgatcattcggtagaaccggggaagtcgataattctggagagtacctac
actggaacacttccaatttcagttacctggaaaaaggatggttttaacataactccatct
gaaaaatgcaacatagtcacaacagagaaaacttgcctcctggaaattctgaatagcaca
aaaagagatgcaggacagtattcctgcgagattgaaaatgaggcaggaaaggatgtgtgc
gaagctctggtatctaccttagaaccaccttattttgttacggaactggaacctctggag
gcctcggtgggcgattcagtttctttacaatgccaagttgctgggacaccagaaattaca
gtgtcttggtacaaaggagacaccaagttacggccaactcctgaatacaggacctatttt
acaaacaatgtggccacacttgtttttaataaagtaaatatccatgacagtggagaatac
acatgtaaagcagaaaatagtataggaactgcttcttctaagactatcttcagaattcaa
gagcgccaactcccaccttcctttgcaagacaattaaaggacatcgaacaaactgttggg
ttaccggttacactcacttgtcgattaaatggctctgcacccatccaagtgagctggtac
agggatggggtactcttaagagatgatgaaaatctacagacatcatttgtagataacgta
gcaactttaaaaattttgcaaacggacttgagtcactctggccagtactcttgctcagct
tctaatccacttggaacagcatcttcaactgctagactgacagcaagagaacctaagaaa
tctcccttctttgacatcaagcctgtatctatagatgttatagctggggaaagtgctgac
tttgagtgtcatgttactggtgctcaaccaatgcgaatcacttggtcaaaagataacaag
gagatccgtcctggaggaaactatacaatcacatgtgtgggaaacactccccatttgaga
attcttaaagtaggcaaaggagactctggtcaatatacttgtcaagcaaccaacgatgtc
ggcaaagacatgtgctcagctcaactcagtgtaaaagaacctccaaagtttgttaagaaa
ttagaagcttcaaaagttgcaaagcagggagaatccacccaactggagtgcaaaataagt
ggttccccagaaatcaaagtgttgtggttccgaaatgacagtgaacttcatgaaagttgg
aagtacaacatgtcattcgttaattctgtggcattgcttaccatcaatgaagccagcact
gaggacagtggggactatatctgtgaagctcacaatggtgttggcgacgccagctgtagc
acagcgctgactgttaaagcacctcctgttttcacccagaagccttctccagtaggagcc
cttaaaggttctgatgttgtcttccaatgtgaaattgcgggaacacccccatttgaagtg
gtgtgggttaaagatcgaaagcaagttcgaagcagcaagaaatttaaaatcacttcgaaa
aattttgatacaagtcttcatatccttaatcttgaagcctccgatgtaggagaatatcac
tgcaaagctagtaacgaggtgggaagtgacacgtgtgtttgcactgtcaagttccaagaa
cctccacgatttgtgaaaaagctaagtgacacctcaacccttgttggggatgctgttgag
ttacgggctgtagtggaaggcttccagccaatttctgttgtctggctgaaagataaaggg
gaagtcatcagagagagtgaaaacactaggatttcattcattgacaatgttgcaactctc
caacttgggagcccagaagcatctaattctggaaaatatgtgtgccaaatcaaaaatgat
gccggaatgagagaatgttctgcagtcttgactgtactagaaccagccagaatcatagag
aagccagaacccatgacggtcactaccggaaatccttttgcattagagtgtgtagtgact
ggaacaccagaactttcaaccaagtggttcaaagatggaagagaattatctggagacagc
aaacatcacattacatttgtcaacaaagtggcttcccttaaaatcccctgtgcagaaatg
agtgacaagggattatatagctttgaggtgaaaaacagtgttggtaaaagtaactgcact
gtatctgtccacgtttcggatcgagtcgtccctccttccttcatccgcaagctgaaagac
ctgaacgccatcctggggtcctcagcggttttggagtgccgagtcgctggctcggccccg
atttccgttggctggtttcaggatggaaatgagatcattagtgggcctaaatgccagtcc
agcttttcggaaaatgtctgtactttgaatctgagctcactggagccctctgacacaggc
gtctacacatgtgtggctgccaacgtggctggttctgacgaatgctcagcagtcctgact
gtgcaagaaccaccatcttttgaacaaacccctgattctgtggaagttttacctggagtg
agcctcacattcaccagcgtctttagaggcacccctcctttcaaggtcaaatggtttaag
ggcagcagggaactggtgtcaggggactcatgcaccatctctctggaagattatgtctcg
gaactggagttgtttgaggtggagccactgcagagtggagactattcttgcctcgttact
aatgatgctggcagtgcttcctgtaccacacatctgtttgtgaaagaaccagccaccttt
gtgaaaagattggctgatttcagtgtggagacaggaagccccatagttcttgaggccaca
tttactggcacgccgcccatctcagtgagctggatgaagaatgaattccctctctcacag
tctcagaattgcactattaccatgacagaaaaatctacgatactggaaattcttgacagc
acgatagaagattatgcacagtacagttgcctgatagaaaatgaggctggtcaagatatt
tgtgatgctctggtgtctgtcttagaaccaccttatttcattgaacctctggaacatgtg
gaagcaaccattggagaacctacaactttacagtgtaaagtggatggaactccagaaatt
agaatttcttggtataaagaacacacaaagctacgatcagctcctgcatataagatgcaa
ttcaaaaataatgttgcctccttagtaatcaacaaagtggatcacagtgacgtgggagag
tattcatgcaaggcagaaaacagtgtgggggcagttgcttcttcagctgtgcttgtcatc
aaagatcgcaaacttccaccttcctttgcgagaaaactaaaggatgttcatgagactctt
ggcttcccagttgcatttgagtgtcgcatcaatggctcagaacctcttcaagtgtcttgg
tacaaggatggggtacttttgaaagatgattctaatttgcaaacatcttttgttcataat
gtcgcaactcttcagattttgcaaaccaaccagagccacgttggtcagtacaattgctca
gcttctaatcctcttgggactgcttcatccagtgccaagctcattctctcagagcatgaa
gttcctcctttctttgatctaaagcctgtctcagtagatctggctcttggagaaagtggt
tcttttaaatgtcatgtaactggaactgcaccaatcaaaatcacttgggccaaggataac
cgagagattcgccctggtggcaactacaagatgactttggttgaaaatactgccactctg
acagttctcaaagtaggcaaaggtgacgctgggcagtacacctgctatgcaagcaacgtt
gctggaaaagattcttgttctgctcatctgggtgtacaagaaccacccagattcattaag
aagcttgaaccttcaagaattgtgaaacaggatgaatacacaagatatgaatgtaaaata
ggagggtctccagaaatcaaagttttatggtacaaagatgagactgaaattcaagagagc
agtaaattcagaatgtcattccttgactcggtggcggtgttggaaatgcacagtctcagt
gttgaagacagcggagactacacatgtgaggcccgcaatgcagcaggcagcgccagcagc
agcacttccttaaaagttaaagaaccacccattttccgcaaaaagcctcatcctgttgag
acactgaaaggagctgatgttcaccttgaatgtgagcttcagggtactcctccgtttcaa
gtttcttggtataaagacaagagagaactcaggagtggcaagaagtacaagataatgtct
gagaacttccttacgagtattcacatcctgaatgtcgatgctgcagacattggggaatat
cagtgcaaagccacaaatgacgtggggagtgacacctgtgctggttccatcactctgaga
gcaccaccaagatttgtgaagacgctcagtgacatttctaccatcgttggtgaagaagtt
cagctgcagactgctattgaaggcgctgagccaatttcagtggtgtggttcaaagataag
ggagaagttgttagagaaagtgacaacatatggatttcttattcagaaaacattgcaacc
ctacagttttcacgagcagaaccagccaatgctgggaaatacacctgtcaggtcaaaaac
gatgctggaatgcaagagtgcttcgccacactatctgttcttgaacctgcagcaattgtg
gaaaagccagaatccatacaagttaccacgggagatacctgtaccttggagtgcacggtc
actggcacacctgaactcagcaccaagtggtttaaggatggaaaagaactgacaagtgac
agcaaatacaaaataagcttcttcaacaaagtatctggccttaagattatcaacgtggca
cccggtgacagtggagtatatagttttgaggtgcaaaatcctgttggcaaagacagctgc
acagcctcagttcgagtctcagaccgaattgttgctccttcattcacaagaaaattgaaa
gagacaaatggtctgtctggttcctcggttgtaatggagtgcaaagtctatggatcacct
ccaatctctgtctcctggttccatgaaggaaatgagatcagcagtggaaggaagtaccag
accaccctgacagataacacttgtgctttaactgtgaactcgctggaagaatcagatgct
ggcgactacacatgtgtagctactaacagggctggttctgatgaatgcagtgctcctttg
actgtgagagaaccgccatcttttgttcagaaacctgatgccatggatgttttaactgga
accaatgtaactttcacgagcatcataaaaggaacacctcccttcatggtcagctggttc
aagggtagcagtgaacttgtaccaggggacagatgtaatgtgtctttggaggattcagtt
gctgaactggagttgtttgatgtagatacaatgcaaagcggagaatacacatgcatagtc
agtaacgaagctggcaaggcttcttgtacaacacatctccatgtaaaagccccagccaaa
tttgtgaagaggctcaatgattacagcatagagaaaggaaaacacctgatcctagagggc
acctacactggaactcctcccatttcagttacatggaagaaaaatggcataaatattgct
ccttctcagaggtgtcatataaccacaactgaaaaatctgcgatcctggaaattccaagc
agcacagtagaggacgcaggacaatacaactgctacatcgaaaatgcttccggaaaagat
tcctgttcagcacaaatcctgatactagaaccaccatattttgtcaagcagttggagcct
gttaaggtgaccgttggagattctgcctctttacaatgccaacttgctgggacccctgaa
attggggtatcctggtataaaggagatacaaaattgagacccactgccacctacaaaatg
cattttaagaacaatgttgctaccctggttttcaaccaggttgatgttaatgacagtgga
gaatatatctgcagagctgaaaacagtgtgggagaagtgtcgtcatccactttcctgact
gttcaagagcaaaaacttccaccatcattttctcgacaattgagagatgttcaagaaact
gttggactgccagttgtttttgaatgtgccataaatggatcagaacctatctcagtgtct
tggtataaagacggcaaaccgttgaaagacggcccaaacgtacaaacatcgtttttagat
aatgtagccactctcaatatttttaaaacagatcggagccttgcaggccagtattcttgc
acagccacaaatccaatagggtctgcttcttctagtgccagactcattctcacagagggg
aagaacccgcccttctttgacatccccgttgcccctgtggatgctgtggtgggagaaagt
gcagactttgagtgccacgttactgggacgcaaccaataaaggtcggctgggccaaagac
aacagagagatacgaagtggtggaaactaccagattagttttctggaaaacagcgcccat
ctgacaatcctgaaagtagacaagggagactctggacaatatacctgctacgctgtgaac
gaagtgggaaaggactcctgcacagctcaactcaacataaaagagcggctcatcccacca
agtttcactaaaaaactctcagagacagtggaagaaacagaagggaattctttcagactt
gagggccgcgttgcgggttcccagcctataactgttgcttggtacaagaataatgtagag
atacatccaacttctaactgtgaaatcacatttaagaacaacacactcctgctgcaagtc
aagaaggcgggcatgggcgatgctggtttgtacacgtgcaaagtgtggaatgatgcaggc
tctgctctgtgtacatcttcaattgttatcaaagaacctcagaagccacctgtgtttgat
cagcaccttactccagtaacagtgagcgaaggtgaattcgtgcagctcagctgccacgtc
cggggttcagagccgatcaggatccagtggttgaaggctggcagggaaataaaaccctca
gacagatgcagcttcagctttgctagtggaaccgctgtgctggaactcaaggacgtgact
aaagcagattcgggagattatgtgtgcaaagcttcaaatgcggctggaagtgacacttcc
aaatcaaaagtgaccgttaaagacaaaccagctgcagtcccagccgctaagaaagcagca
gtggacgggaaactcttcttcgtatcagaacctcagagtatcagagtcgtagaaaaaacc
actgcaacattcattgccaaagttggaggtgatccaatcccaaatgttaaatggacaaaa
gggaaatggagacaactgaaccaaggaggtcgcatttttatccaccagaaaggcgatgaa
gcaaagctggagattagagacaccacgaaaaccgattctggactataccgatgcgtcgca
tttaataaacatggtgaaattgaaagtaatgttaacctacaggtggatgaaaggaagaaa
caagagaaaattgaaggagatcttagggcaatgctgaaaaagactccagtcttaaagaaa
ggagctggagaagaagaggaaattgatatcatggaacttctcaaaaatgttgatcctaaa
gaatatgaaaaatatgcccgtatgtatggaatcactgacttccggggtcttcttcaagca
tttgaactgctaaagcaaagtcaacaagaagagacacatagattggaaattgaggaaata
gagaagtcagagaaggaagaaaaggaatttgaagaacttgtatcatttattcagcaaagg
ctgtcacagacagagcctgtcactctgatcaaggatattgaaaatcagacagttttgaaa
gataatgatgctgtgtttgaaattgatattaagattaattatccagaaatcaaactctca
tggtacaaagggactgaaaaactggaacccagtgataaatttgaaataagcatcgatggt
gatcgacatacactcagagtcagaaactgtcagcttaaagatcagggcaattatagattg
gtgtgtggtccacacatcgctagtgctaaactcactgtaattgagcctgcttgggaacgg
catcttcaagatgttactttgaaagaaggccagacttgcaccatgacatgccaattttct
gtgccaaatgtaaaatctgaatggttcagaaatggcagaatccttaaaccccaaggtaga
tacaaaacagaagtggaacacaaagtccataagctgaccattgcagatgttcgagcagaa
gaccagggacagtacacctgcaaatacgaagaccttgaaacatcagcagagctcagaatt
gaagctgaaccaattcagtttacgaaacgcatacagaacattgtggtgagtgagcatcaa
tctgccaccttcgagtgtgaagtgtccttcgacgacgccattgtaacatggtacaaagga
ccaacagaactgaccgagagccagaaatacaactttaggaatgatggtcgctgccattat
atgaccatccacaacgtgaccccagatgatgaaggtgtctattcagtaattgctcgcctg
gagccaagaggtgaagcgagaagcacggcagagctgtacttaacaaccaaagaaatcaaa
cttgagatgaagcctcctgatattcctgactccagagttccaatcccaaccatgcctatc
agagcagtgccaccagatgaaatccctcctacggctattcctcctatccctctgttacta
ccagcacctgaagaaaagaaaccaccagcaaaacgtgttgaagtgaccaaaaaagccaag
aaagtcgcaaagcccaaagaagaggcaccgccgcctaaagtcccagaggttgccaagaag
cccccgcctcccactgccttaattccagccaaagctcctgaaattattgacgtatcctcc
aaggctgaagaagtaaaaataatgaccataaccagacagaaagaggttcagaaagaaaaa
gaagctgtgtatgagaaaaagcgagcagtctatgaggagaaaaaacttttcatcgaatct
ttggaagaaccatatgacgaactggaagtggaaccatacacggagccatatgaagaacct
tactatgaagaaccagatgaagactatgaagagaccaaggtagaagccagaaaggaagtt
catgaggaatgggaagaagattttgaagcagggcaagaatactatgaaagggaagaaggt
tatgacgaaggggaggaagagtgggaggagacttaccaagaaagagaagcagttcaagtt
caaaaggaggtttatgaagaaccacatgagagaaaaattccagcaaaagtgcctgaaaag
aaagaagcaccacctcctaaagttgtaaagaagccagtagttgaaaaaattgaaaagact
tctcgaagagtggaggaagcaaaagttcaagtcaccaaagtacctgaagtttcaaagaag
attgttccacaaaaaccttcccggactccagtgcaggaagaagttattgaagtgaaagta
ccagctgtgcatacagagaagatggttatttcagaagaaaagttctttgcttctcacaca
gaggaagaggtgtcagtcacagtccccaaggtacaaaagaaaactgttaccgaagagaaa
attcaagttgctgtttccaaaaagattgagcctccacctaaagtccctgagccacctcgg
aaaccagccccagaagaagtggtccctgttcccattcctaaaaaggtggaacccccacca
gccaaagttcctgaagttcccaagaaacctgtgccagaagagaaaaagcctgttcccgta
cccaagaaggaacctgctgctcccccaaaagtcccagaggtgccaaagaaacctgtccct
gaagagaaggttcctgttcctgttgcaaagaaaaaggaagctccaccagctaaagttgct
gaagtgcagaagagggttgtcacagaagaaaaagtaaccattgttactcaaagagaggaa
tctccaccaccagcagtgccagaaataccaaagaagaaagttcctgaagaaaaaagacct
gttcctcggaaagaggaagaagctccaccaccaaaagtgccagctccgcctaagaaaccc
gtcccagaggagaaagttcctgtaccagttcctgtccctaagaaagctcctcctccccga
gccgaagtgtctaagaaagctgtcgtagaagaaaaaagatattttgccgaagaaaaacta
tccgttgcagttcctcaaagaacggaagtcgtgcggcacgaagaggaggaatggagttat
tcagaagaacaggaaagagtgtccatttcagtttatagagaagaagaaagagaggaggag
gaagcggaggttacagaatatgaagtgatggaagagcctgaggaatacgttgtggaggaa
gagctgcacgttattgctgagagagtggaagctgagccagcagaagtgcctgagaagaaa
attgtaccaaaaccgaaaattcctgctaaaatagaggagccttcaccagctaaagttcct
gaaccacctaagaaaatcgtgccagaaaagaagcttcctgctgctgttcctaagaaggaa
aaggtgccaccagctaaagtgccagaagagccaaagaaaccagttccagaaaaaagggct
cctccaaaagtggctaagatagaagagcctgtccccaccaaagtgactgagaggcacatg
caaattacccaggaagaaaaagttcttgttgctgtaactaaaaaagaggagcctccaaga
gcaagagtgccagaagaacccaagagagctattccagaagagaaagttccaaaactcaaa
cctaaaaaagaggaggagccaccaacaaaagtggctgaaatcaggaaaagagctgttaaa
gaagaaaaggtatccattgaagttccaaaaagagaacctcaattcgctaaagaagtagct
gtagcagaagagaaagaatggtcttatacccgagaagaagaggttgtctcagtacaacgg
gaagaggaatatgaagaatatgaagaagaatatgattacaaagaatttgaggagtatgaa
ccaacagaagagtatgagcaatatgatgaatatgaggaacgtgaatttgaacattatgaa
gagtataaagaacgtgaagaatatgtcacagagcctgagaagcctgtcccagttaagcct
gtccaagaagaaccagttcccacaaagccaaaggccccaccagtgaaagtgccgaagaaa
gctgtccctgaagaaaaagtaccagtgcccattcctaagaaactcaaacctgtgccaccc
aaagtgactgaagaagcaaagaaagttgttgaggaaaaaatacacatttcaattaccaaa
cgtgaaaaagagcaggtgaccgaaccaactgctaaagtgcccctgaagctcaaaagggtt
gtcactgaagaaaaagtaccagttcctaaaaaggaagtagccgcacctgttagagtgcca
gaagtacctaaaagacgagaaccagaagagatagcctttgaagaggaagttgtaacccaa
gtagaggaatatcatgaagaagaagaagagtacatttacgaagaagaggaactcgtaact
gaagaagaagtggtaccagtgataccagtcaaagtgcctgaggtacccaagaaacctgtt
ccagaagagaagaaacctgttcctgttcccaaaaagaaggaagccccaccagcaaaagtg
cctgagattcctaagaagccagaggaaaaagttcctgtgcccattcctaaaaaagagaag
gctccaccagctaaagttcctgaggtacccaagaaacctgtaccagaggagaaagtgcca
gtaccagttcctaaaaaggtggaagctccacctgccaaagtgccagaagtacccaagaaa
cctgtgcctgagaagaaggtgccagttcctgttcctaagaaagtagaagctccacctgca
aaagtgccagaggtgcctaagaagatcatcccagaagaaaagaaaccaacacctgttccg
aaaaaagtggaagctccaccacccaaagttcctgaggtacctaagaaagtggaagaaaga
ccaatcgttgtccctgaagaagaggaagttccaccagttgaagtgtttgaggagcctgaa
gagcctattccagaagaagagatcccagaagaaccacctaccatagaggaggaggttgaa
gaagtagcaccacctagagtgcctgaagtggtcaagaaagcagtacctgaagcacctact
cctgttcctaaaaaagtagaggcaccaccagctaaagttccaaagaaggttcctgaggaa
aaagtacctgttcctgttcagaaaaaagaggcacctccagccaaagtgcccgaagtacaa
aagaaagtcccagaaaagaaagtcccagaaaagaaaatcccagaaaagaaagtcccagaa
aagaaagtccttgtgcctaaaaaagaagctgttcccccagctaaagatgctctttcaggg
aggactgtcgaagaaaaaatatcagttgccttccacaaagaggaagtagttagagaaaga
acagaatttgaaatagtagaagcggaagcagttcttgaggaagaagagttccatgaagtt
gaagaatattttgaagaagaagagttccacgaagtagaagaattcaccaaagtggaagag
cacagatttgaagaagtccacgaggttgaagaggtccgtagggtaatagaagttttagag
gctgaagaagtggaagtttacgaagaacccaaagctccacctaaagtgcctgaggctccc
aaggaagttgttcctgaaaagaaagtgcctgcgccacctcctaaaaagccggaagtccca
cctgttaaagtgcccgaggctcccaaggaagttgttcctgaaaagaaagtgcctgcggca
cctcctaaaaagccggaagtcccaccagccaaagtgcctgaggtgccaaaggcagctgtc
ccagaaaagaaagtgcctgaagctattcctcccaaaccggaaagtcctccccctgaagtg
cccgaggtgccgccaaaggaagtcatccctgaaaagaaagtgcctgtggctcctcctaag
aagccagaacctccacctgctaaagtgcctgaagctcccaaagaagttgttcctgaaaag
aaagtacctgtgccacgtcctaaaaagccagaagttccacctgtcacagtgcccgaagct
cctaaggaagttgttcctgaaaagaaagtgtctgtggcacctcctaaaaagccagaagtc
ccacctgttacagtgcctgaagctcccaaagaagttgtccctgaaaagaaagtgcctgtg
ccacttcctaaagagccagaagtcccacctgttaaagtgcccgagcctcccaagaaagtt
gttcctgaaaagaaagtacctgtggcgcctcctaaagagccagaagtcccacctgttaca
gtgcctgaagctcccaaagaagaaatcatccctgaaaagaaagtgcctgtgccacctcct
aaaaagtcagaagtcccacctgttaaagtgcccgaggctcccaaggaagttgtccctgaa
aagaaagtgcatgtgccacctcctaaaaagccggaagtcccacctgttaaagtgcctgag
gctcccaaggaagttgttcctgaaaagaaagtgcctgcgccacctcctaaaaagccggaa
gtcccacctgttaaagtgcccgaggctcccaaggaagttgttcctgaaaagaaggtacct
gcggcacctcctaaaaagccggaagtcccaccagccaaagtgcccgaggtgccaaaggca
gctgtcccagaaaagaaagtgcctgaagctattcctcccaaacccgaaagtcctccccct
gaagtgtatgaggagcctgaggaagttgttccggaagagcctccagctgaagtggtggaa
gagccagagcccgcccctccccccaaagtgactgtgccacctaagaaacctgtcccagag
aagaaaccacctgctgtcattgccaaaaaacctgaaccaccaccagtgaaagtgcccgag
gtgcccaaggaagttgttcctgaaaagaaagtgcctccagtggttcccaaaaagccagaa
gtcccgcctgctaaagtgcctgaagttccaaaagaagttgttccagaaaagaaagtagct
gttcccaaaaagccggaagtcccaccacccaaagtgccagaggtgccaaaggaacctgtc
gtggaagagaaaccagctgttcctattcccgaagaagtggagccgcctcctccagaagta
tatgaagaacccgaggaaattgctcctgaagaggaagagccagttcctgttgcagaggag
gaaccagaggcgcccccaccagcagtgcctgaagagcccgagaagattgttccagagaag
aaagtgcctgtcatcaaaaaaccagaagctcctcctcctaaagaacctgaacctgaaaag
aaggttgttgagaaaccaaaactcaaaccaaggcccccagctcctgctcctgctccacct
aaggaagacgtgaaggagaaaatagcccaacttaaagctgtttcaaagaagaaagttcct
gaaaaacctgaggttccagaaaaagtggagcttaaacctctgaaagtgcttggaggggaa
aagaaagttcgcaaattacttcctgaacctaaaccgcaaccaaaggaagaagttgttctc
aaaagcgttctaagaaagaaacctgaagaagaagaacctaaagtagaacctaaaaaagta
gaaaaagttaaaaaacctgcagtaccagaaccacctccaaagcctgttgaagaggttgaa
gcacctccagctgctgttacaaaaagggaaaagaaagttcccgaaccaacaaaagtgccc
gaaattaagccaccaatacctctccctgcacctgaaccgaaaccaaagcccgaaccagag
gtgaaaataatcaaaccacctccagtggagcctgcaccaacccccatcgcagccccagtg
accgtgccagtagttggaaagaaagcagaagccaaagcacccaaagaggaggctgccaag
ccgaaaggtcccatcaaaggtgtagccaaaaagactccttcaccaatagaacttgaaaag
aaaaagttgagaccaggaagtggtggggagaaacctcctgatgaagccccgttcacctac
cagctgaaggctgtgccactgaagtttgtgaaagaaatcaaagacatcgtcttgaccgaa
gcagagtcagttggctcttctgcaatttttgaatgtctagtctctccctctactgccatt
acaagctggatgaaagatggtagcaatatccgtgagagccccaaacacagattcatcgca
gatggtaaagacagaaagctgcatatcattgatgttcagctttctgatgctggcgaatac
acctgtgttttacgtttgggaaataaagaaaagacctccacggcaaaacttattgtagaa
gaacttcctgtgcgctttgtgaaaacgcttgaagaagaagtcacagtggtcaaaggacag
ccattgtacttgagctgcgagttaaacaaagagcgcgatgtggtctggaggaaggatggg
aagattgtggtggagaagcctggcaaaattgtgcctggtgtcattggcttgatgcgggcc
ctgactatcaatgatgcagatgacactgacgccggaacgtacacagttactgtggaaaac
gccaacaacctggaatgttcatcttgcgtaaaagtcgtagaagtcattagagactggctg
gtgaaacccatacgagatcagcatgtgaaacccaaggggacagctgttttcacctgtcat
atagcaaaggatactccaaacattaagtggttcaaaggatatgatgaaatcccctgggaa
ccaaatgataagactgagatagtgaaagatggaaatcatctatccctcaaaattaagaat
gccacaccagaagatattgatgaatatgcagtggaaattgaagggaaaagatatcctgca
aagctaacacttggagaccgcgaagttgaattgcttaaaccaatagaggatgttaccatt
tatgagaaagaaagtgcaagctttgatgcagaaatctcagaggcagacattcctggacaa
tggaaactgaagggagaactcctaaggccttcacctacttgtgaaatcaaagcagaaggt
gggaaacgcttcttaactttgcacaaagtcaaactggaccaagctggtgaagtcctttac
caggccctcaatgcaattacgacggccattctgacagtaaaagaaatcgaacttgacttt
gctgtgcccctgaaggatgtcactgttccagaaaagcgacaggctcgatttgaatgtgtc
ctcacccgagaggcaaacgttatatggtctaaagggcctgatatcatcaagtcatctgac
aagtttgatatcattactgatggaaagaaacacattcttgtcatcaataattctcaattt
gatgacgaaggggtctataccgcttcggtggagggcaagacgacctcagcacgattattt
gttacaggtataagattgaagttcatatcgcctcttgaagatcaaacagtgaaagaaggt
gaaacagcaacttttgtttgtgagctttctcatgaaaaaatgcatgtagtctggttcaaa
aatgatgtcaaactccacacgagcagaactgtactcatctcatctgagggcaaaactcac
aaattggaaatgagagaagtgaccctggatgatatatcccagataaaagctcaagtgaag
gacctgagctccacagcaaacctaaaggtcttagaggccgatccctacttcactgtgaaa
ttacatgacaaaactggagtcgagaaggatgagattattctgaagtgtgaagtgagcaaa
gatgtgccagtgaaatggttcaaagatggtgaagagattgaaccttcacccaaatactcc
atcaagtcagacggcctgcgccgcatcttaaaaatcaaaaaggcagaacttaaagataaa
ggcgaatatgtgtgtgactgtggcacagacaagacaacagcaaatgttaatgttgaggct
cgactaataaaagtggaaaaacctctgcgtggagtagaattgtttgttggtgaaacagct
cgctttgaaattgagctttctgaaccagatgttcatggccagtggaagttaaaaggagag
cctttaactgcttcccctgactgtgaaatcattgaagatgggaagaagcatattctggtc
ctttataactgccagctggatatgacaggagaggtctccttccaggctgccaatgctaaa
tctgcagccaaactgaaagtgaaagaattgccacttatcttcatcacacctctcagtgat
gttaaagtctttgagaaagatgaggctaagtttgagtgcgaagtatccagggaacccaaa
acattccgttggctgaaaggaacccaagaaatcacaggtgatgacaaaattgagcttata
aaggatggcactaagcattcaatggtgatcaaatcagctgcttttgaagatgaagcaaaa
tacatctttgaagctgaagataagcacacaagtggcaaactgatcattgaaggaatccgg
ctcaaattcctcaccccactcaaggatgtaacagccaaggagcgggaaagtgccgtgttt
actgtggagctgtcccatgataacatccgcgtcaagtggttcaaaaacgaccagcgcctg
cacaccaccaagttggtctcaatggaagatgaagggaagattcattccatcacattcaaa
aacctctctattgatgacacctctcaaattaaagtagaagctatggggatgagttcagaa
gctaaactcactgtgcttgagggagatccatactttacaggaaagcttcaagattacact
ggcgtagagaaagatgaagtggttctacagtgtgaaattagcaaagcagatgcaccggtg
aagtggtttaaggatggggaggaaataaagccatccaaaaatgctattattaaggcagat
ggcaagaagcgcatgctaatactgaagaaagccttaaagtcagatattggacagtacacc
tgcgactgtgggacagacaagacctcaggaaagcttgacattgaggatcgggaaattaaa
ctggtgcgacccctgtacagtgtggaggtgatggagactgagacggcccgctttgaaacc
gaaatctcggaagatgatatccatgccaactggaaactcaagggagaggcactgctccaa
acacctgactgtgagatcaaggaagaaggcaaaacgcacttcctaattttgcacaactgc
cgcctggaccaggccggtggggtggatttccaagctgccaatgttaaatctagtgcccac
ctccgagtaaaaccacgagtaattggtcttctgaggcccctgaaggatgtcacggtgact
gcaggggaaacagccactttcgactgcgagctctcttatgaggatatcccagtggaatgg
tatctcaaagggaagaaactggagcccagcgataaggtggtcccacgttcggaaggaaga
gttcacacacttactctgagggatgtaaagttagaagatgctggagaagtccaactaaca
gcaaaagatttcaaaactcaagccaaactctttgtgaaagaacccccagttgaattcact
aagcctcttgaggaccagacggtcgaagaggaagccactgcggtattggagtgtgaagta
tccagagaaaatgcaaaggtgaaatggttcaaaaatgggacagaaattctcaaaagcaag
aagtatgaaattgttgctgatggcagggtcagaaaacttattatacatggctgtacccca
gaggatattaaaacatacacttgtgatgctaaggattttaagacttcctgtaacctgaat
gtcgtgcctccgcatgtggaattcttaagaccactcaccgatcttcgagttaaagaaaaa
gaaatggctcgatttgagtgtgaactctcccgagaaaatgccaaggttcactggttcaaa
gatggtgctgaaattaaaaagggcaaaaaatatgatattatatctaagggagctgtgcgc
attctggtcatcaacaaatgtctacttgatgatgaagcagaatattcctgtgaagtaagg
acagcaagaacttctggcatgctgacagtagtggaagaagaagctgtctttaccaaaaat
cttaccaacgttgacgttagtgaaacagacactataaaactggtttgtgaagtctccaag
cctggagcagaagtgacttggtacaaaggggatgaagagatcattgaaacaggaagatat
gaaatacttactgatgggcgaaagagaatcctgatcattcagaacgctcaccttgaggat
actggcaactacaactgccgactcccaagttctcgaactgatggcaaagtcaaagtacat
gaacttgctgctgaatttatctcaaagcctcaaaaccttgaaatacttgaaggagaaaag
gctgaatttgtctgctctatatcaaaggaaagctttgaagtccaatggaagagagacgat
aagacacttgaatctggagataaatatgacgttattgctgatggcaaaaagaggatccta
gttgtgaaagatgccacgttacaagatatgggcacttacgtagtcatggttggggccgcc
agagcagcagctcacttgacagtaattgaaaaactcaggatcatagttcctcttaaggac
acccgtgtgaaggaacaacaagaagtcatcttcaactgtgaagtcaatactgaaggtgcc
aaagccaaatggttcagaaatgatgaagccatatttgatagttcaaaatacattattctc
caaaaagacctggtctacaccctcaggattagagatgcacgattagatgatcaagccaac
tatagtgtgtctctgaccaatcatagaggtgaaaatgttaagagtgcagccaatctaata
gtagaagaggaagaccttaggattgttgagcctcttaaagatattgaaacaatggagaag
aaatctgtcacattctggtgcaaggtgaatcgtctcaatgtaacactaaagtggaccaaa
aatggagaagaggtggcttttgacaaccgtgttttatacagaattgataaatataagcac
tctctaatcattaaagactgtggcttcccagatgagggtgaatacatcgtcactgctgga
caagataaatctgttgctgagcttctcatcatagaagcccctacagaatttgtggaacac
ttggaagaccagacagtcactgagtttgatgatgctgtcttctcctgccagctctccaga
gagaaagcaaatgtaaaatggtacagaaatgggagggaaatcaaagaaggcaaaaaatac
aaatttgaaaaagatggaagtgtacatcgactcattataaaagattgcaggctggatgat
gaatgtgaatatgcttgtggagtggacgacaggaagtctagagctagactttttgtggaa
gaaatccctgttgagatcatcaggcctccccaagatattcttgaagctcctggtactgat
gttgtcttttgggctgagctcaacaaagataaggtggaagtccaatggctaaaaaataac
atgattattgtccagggtgacaaacaccaaatgatgagtgaaggaaagatacacaggcta
cagatttgtgacattaggccacgtgaccagggtgaatacagatttattgctaaagacaaa
gaagccagagctaagcttgaactggcagctgcacctaaaatcaagacagctgatcaagat
cttgtggttgatgttggccagcctctgacaatggtggtgccctatgatgcctaccccaaa
gcagaagctgagtggtttaaagaaaatgaagctctgtcttcaaaaactgttgatactaca
gctgaaaaaacttctttcagaattttagaagccaagaaaggagacaaaggaaggtataaa
attgtgcttcagaacaaacatggaaaagcagaagccttcatcaatttacaagttattgat
gttcctgggccagtacgtaacttagaagtgacagaaacacttgatggtgaagtgagcctc
gcttgggaagaaccattaactgatggtggaagcaaaatcataggttatgttgttgaaaga
cgtgacatcaagagaaagacctgggttctggccactgaccgtgcagacagttgtgagttt
actgtcactggactacaaaaaggaggagttgaatacctattccgtgtgagtgcaagaaac
agagttggcactggtgaaccagtagaaactgccaatcctgtggaagcaaggagtagatat
gacgttccaggccctcctttgaatgtgaccatcacagatgtgaatagatttggtgtctca
ctgacatgggaaccaccagagtatgatggaggggctgagatcacaaattacatcattgaa
ttaagagacaaaacttctatcagatgggacactgccatgacagtaaaagctgaagacttg
tctgcaactgtcactgatgtggtggaaggacaggagtatagtttccgggtcagagcccaa
aaccgaattggagttggaaaaccaagtgcagccacacctttcgtcaaagttgctgatcca
attgagagaccaagtcctcctgtgaacctaagttcctcagatcagactcagtcatcagtt
cagctcacatgggaacctcctctgaaagatggaggaagcccaatattgggctacataatt
gagcgatgtgaagaaggaaaagatgagtggattcgttgcaataagaaacttgtccctgaa
ctgacttacaaggttactggattacaaaaaggaaataaatatttatatcgagtatctgca
gaaaatgaagctggtgtttcagatccatctgaaattcttggtcctctaactgctgatgat
gcatttgctgaaccaacaatggatttaagttcatttaaagatggtctggaagttattgtc
ccgaaccctatcaagatcctggttccaagtacaggctatccaaggccaactgcaacctgg
gcgtttggagataaagtactagaagcaggggaccgtgtgaaaatgaaaaccttatctgcc
tatgctgaactggtcatttctccaagtgaacgtccagacaagggcatttatacactgaaa
ttagaaaatcgtgtgaaagcaatttctggggaaattgatgtcaatgtaattgctcgccca
agtgcacccaaagaactgaaatttgatgacataaccagggactcagtacatttgacttgg
gaaccaccagatgatgatggaggaagtccattaactggatatcttgttgaaaagcgagaa
gtcaaccggaaaacatggactaaagttatagactctgtgactgacctagaattcacagtt
cctgatcttgttcaaggaaaagaatatttatttaaagtctgtgctcgtaacaagtgtggc
cctggagaacctgcatatgttgatgaacctgtaaatatgtcagctcctgcaacggtacct
gacccaccagagaatgttaaatggagagatcgaacagccaagagcatcttcctaacatgg
gatccacctaaatatgatgggggttcacgcatcaaaggatatatagttgaaaaatgtcca
cgtggttctgatcgatgggttgcctgtggggaaccagttgcagaaacaaaaatggaagtg
acaggccttgacgaaggccagtggtattcctaccgtgtgaaggccttgaataggcaaggt
gccagcaaaccaagcaagcccacagatgaaatccaggctgtggacgcacaggaggctcca
gaaattttcctcgacgtgaagctccttgctggtctcactgtaaaggcaggaactaagatt
gaacttcctgccactgtcactggaaaacctgaacctacaataacttggacgaaggctgac
acgcttctgaggcaggacaaaagaatcaccattgaaaatgttcctaaaaaatccaccgtg
actatcgtcgatagcaagagaagtgacactggcagatacattatcgaggctgtgaacgtc
tgtggtcgggccactgccgtggcagaagtgaacgtcttagataaacctggaccaccagct
gcttttgacatcacagaagtgaccaacgagtcatgtcttctaacatggaacccaccacga
gatgatggtggatctaaaatcacaaactatgttgtggagagaagagcagctgacagtgat
atgtggcacaagctctcatcaactgtcaaggatacaaaattcaaggcaaccaacttaatc
cccaataaagaatacctcttcagagttgctgcagaaaacatgtatggtgttggtgaacca
gttcaggccactccaataacagccaaatatcagtttgatccacctggacctccaactcgc
cttgaaccttctgatatcactaaagatgcagtgactctcacatggtgtgagccagatgat
gatggtggcagcccaatcactggatattgggttgaaagattagatcctgatactgataaa
tgggttaggtgcaataagatgccagtaaaggacacaacatacagagtgaaagggctcacc
aataagaaaaagtacagattccgtgtgttggctgaaaatcttgctggacctggaaaacca
agtcgatcaacagaaccgatcttaataaaagatcccatagaccctccatggccccctgga
aaaccaactgtgaaagatataggcaaaacgtcaataatgttgaattggacaaagccagaa
catgatggaggggcaaagattgagtcttacgtcattgaaatgctaaagactggaacagag
gactgggtccgagtggctgaaggggttcccaccactcagcatttgctcccggggctcatg
gaaggtcaggaatactcattccgagttagagctgtgaacaaggccggggaaagtgaaccc
agcgaacccagtgaccctgtgctttgccgggagaagctatatcctccatcaccacctcgc
tggcttgaagttattaatatcacaaaaaatacagcagacctaaagtggacagtccctgag
aaagatggagggtcccccatcaccaactacatcgtggaaaagagagatgtgaggcgaaaa
ggctggcaaacggtggacacgaccgtcaaggacaccaagtgcacagtaaccccactgaca
gagggctccttatatgtgttccgagtcgctgcagaaaatgccataggacaaagcgactac
tgtgaagtcgaggactccgtcctggccaaagacactttcaccacacctggaccaccctat
gctctgacagtggttgatgtgacgaaacgacatgttgacctgaagtgggaaccacctaaa
aatgatggtggaagaccaatacagagatatgtcattgagaagaaagaaaagttaggcacc
cgttgggtgaaagctggaaagacctcaggacccgactgtaacttcagagtaactgatgtc
attgaaggaacagaggtccagtttcaggttcgggcagaaaatgaagctggagttggtcat
ccaagtgaacccacggaaatcctgtcaattgaagatccaacaagtcctccttcacctccc
cttgacctgcatgtgactgatgctgggagaaagcacattgccattgcttggaagcctcca
gagaaaaatggtggaagccctattataggataccatgttgaaatgtgtccagtaggcact
gaaaaatggatgcgagttaattctcgcccaataaaagacttgaaattcaaggttgaagaa
ggcgttgttcctgacaaggaatatgttctgagagtgagagctgtcaatgctgttggtgtc
agtgagccatctgaaatctccgaaaatgtggttgccaaagacccagattgcaagccaaca
attgatctggagactcacgacattgttgttattgaaggtgaaaagttaagcattcctgtt
cccttcagagctgtcccagttccaaccgttagttggcataaagatggcaaagaagttaaa
gcaagtgatagattaacaatgaagagcgatcacatctctgcacacctcgaagttcccaag
agtgtccatgcagatgctggagtttacaccattacactggagaataagcttggctcagca
actggctcaatcaatgtcaaagtcataggcctacctggaccatgcaaagatattaaagca
agcgacgtgaccaagagttcttgtaaattaacctgggaacctccagaatatgatggtgga
agcccaattcttcattatgtcctggaacgcagagaagctgggaggaggacatatatacca
gtcatgtctggtgagaacaaactgtcctggactgtaaaagatctcataccaaatggtgaa
tacttcttccgtgttaaggctgtcaacaagattggtggaggcgaatatattgaactgaaa
aatccagtcattgctcaagatccaaagcagccccctgatccacctgtagatgttgaggtt
cataatcctacagcagaggcaatgactattacatggaagccacctttgtatgatggaggg
agcaagataatgggttacatcatagagaagattgctaagggtgaagagagatggaagaga
tgtaatgaacacctggtacccgtcctgacctatacagcaaaaggactcgaagagggaaag
gaataccagttccgtgtgcgagcagaaaatgctgccggtatcagtgaaccttctcgggcc
actcctccaaccaaagctgtagatcctattgatgccccaaaagtcattctgagatcaagc
ctagaagtgagacgaggtgatgaaatagcactcgatgcaactatttctgggtcaccttac
ccaactattacatggataaaggatgaagaaattattacaccagaggaaattaagaagcga
gtagcacccatggttaggaggaggaggggtgaagttcaagaagaagaaccatttgtcctg
tctctgacggagcgtttgagcattgacaatagtaaaaaaggagaatctcaactacgcgtc
cgagattctattcgacctgaccatggccaatatatgatcaaagctgaaaatgaccatggt
attgcaaaagctccttgcactgtcagtgtgctagatacaccaggaccaccgatcaacttc
gtatttgaagatgttagaaagaactcagtcgtctgtaaatgggaaccaccccttgatgat
ggtggcagtgaaattataaactacactttggaaaagaaagacaagacaaaacctgactcc
gaatggattgttgtcacttcaacacttagacattgcaaatatccagtgacaaagctgatt
gaaggaaaagagtacctcttccgtgtaagagcggaaaataggtttggacctggaccacca
tgtgtttcaaagccacttatagctaaagatccatttgaaccacctgatgcacccgataag
cctattgtggaagatgttaccagcaacagtatgctagtgacatggaatgaaccaaaagat
aatggaagccccatcttaggttactggcttgaaaaacgtgaggttaatagtacacattgg
tcccgtgtcaacagaaacctcctcaattctttgaagaccaatgtagaaggcctattagag
ggactcacctatgtcttcagagtatgtgctgaaaacgcagctggacctggaaagttcagt
cccccttcagatcccaaaacagcacgtgatccaatcgctccacctgggccacctgtccca
agagtcgctgacacaagctctacaaccattgaactcgaatgggaacccccagctttcaat
ggtggtggggaaattattggttactttgtcgataagcagctggttggcacaaatgaatgg
tcacgctgcacagagaagatgatcaaggcccgtcagtacacggtcagagaaatccgagag
ggtgctgattacaaacttcgagtgagtgctgtcaatgctgcaggtgaaggaccacctgga
gagacagaacctgttactgtggctgaaccaaaagagcctcccactgtggaactagatgtt
tctgtcaaggctggaatacaaataatggctgggaagactcttagaattccagctgtggta
actggtcgtccagtgcctacaaaagtatggacaatagaagaaggggagctggataaagac
cgtgttgtaatagagaatgttggaaccaaatctgaactaattatcaagaatgcattgaga
aaagatcatggcagatatgtgattacagctaccaatagctgtggttccaaatttgcagcc
accagggtagaagtttttgatgtccctggtccagttcttgacttaaaacctgttgtaaca
aacagaaagatgtgtctgcttaactggtctgatccagaagatgatggaggaagtgacatc
acgggctttattattgaaagaaaagatgctaagatgcatacttggagacaaccaatagag
actgacagatctaaatgtgacatcacaggtctccttgagggacaagaatatatgttccgt
gtgattgccaagaacaagtttggctgtggccctcctgttgaaataggaccaattcttgca
gttgatccactaggtcctccaacgtctcctgagaggctcacatatacagaaaggacgaag
tccactatcaccctggactggaaagagccccgtaacaatggtggcagccccatccaaggc
tacatcattgaaaaacggcgtcacgataaacctgactttgaaagagttaacacgcgactc
tgcccaaccacgtcttttctggttgaaaatcttgacgaacaccaaatgtatgaattccgt
gtcaaagccgtcaatgaaattggtgaaagtgaaccatccttgcctcttaatgtggtcata
caagatgatgaagtgcctccaactattaagttgcgcctggctgttcgaggagacactatc
aaagttaaggcaggagagcctgttaacatccccgcagatgtgacaggccttccaatgcct
aagattgagtggtccaagaatgaaactgtgattgaaaaacccactgacgcacttaagata
acaaaggaagaagtatcccgaagtgaggcaaagactgagcttagcattcccaaagcagtc
cgggcagacaaaggcacttacacagttactgcttccaatcgccttggctcagtgttccga
aatgttcacgttgaagtatatgatcgtccatccccaccaagaaatcttgctgttactgac
attaaagctgaatcttgctacttgacttgggatgctcctctagacaatggtggcagtgaa
attacccattatgtcattgacaaacgtgatgcaagtaggaagaagagtgaatgggaggaa
gtcaccaacactgctgtagagaagagatatgggatctggaaacttatccccaatggtcag
tatgagttccgagtaagggcagtgaataaatatggaatcagtgatgactgcaaatcagat
aaggtggtcattcaagatccttatcgcccacctggacctccgggaaaaccaaaagtcttg
gagcgcaccaaagggtcgatgctagtgagctggactcctcctttggacaatggcggctct
ccaattactggctactggctggagaagagagaagagggaggtgcctactggtcacgtgtt
agccgagcaccaataactaaaacgggattgaaaggcgtggaatttaatgttcctcgtttg
attgaaggcgttaaataccagttcagagcaatggcaataaacgctgcaggagttggccct
cccagtgaaccatcagatccggctgttgcaggagatcctatatacccacctgggccacct
tcttgcccagaggtcaaagataaaacaaagtcaagcatctcgctagcatggaaacctcca
gccaaagatggtggcagtcccatcaaaggatacattgtagaaatgcaagaggaaggtact
actgactggaaaaaagtaaatgaaccagacaaacttctaactacctgtgaatgtgtggtg
ccgaatttgaaagaactcaggaagtacagattcagagtaaaagctgtcaatgaagctggt
gaatctgaaccaagtgatacaactggagagatccctgccactgatattctagaggtacca
gaagttttcattgacattggagcacaggactgtctgatttgtaaagctggctcacagatt
aggattcctgctgtcatcaagggacgcccaacaccaaaatcatcttgggaatttgatgga
aaggcaaagaaggcattgaaggatggagttcatgacatacctgaagatgcacagctggag
actgctgaaaactcatcagtaattattattccggagtgtaaacgatctcattcaggcaaa
tacagcatcacagccaagaataaagcaggacaaaagactgcaaattgcagagttaaagtc
atggatgtaccaggcccacccaaagatctgaaagtcagtgacatcacaaggggtagttgc
agactttcatggaagatgccagatgacgatggaggagacaggatcaagggttatgttatt
gagaagaagactattgatggaaaagcctggactaaagtcaatccaaactgtggaagcacc
acatttgtgattcctgatctcatctctgaacagcagtatttcttccgcgtgcgtgcagaa
aaccgttttggtattggtgcacctgtggaaaccattcagaggaccactgccagagatcca
atatatcctcctgatccccctattaaactcaagattggcctcataacaaagaacacagta
cacctgtcatggaaacccccaaagaatgatgggggctcccctgtcacccactatattgtt
gagtgtcttgcatgggaccctactgggaaaaagaaagaagcatggaaacagtgcaataag
cgtgatgtggaagaactggaatttaccgtggaagacctcgtggagggaggggaatatgaa
ttcagagtcaaagctgtcaacgctgccggagtcagcaaaccttcagaaactgtgggccct
gtgattgtcaaagatcagacatgcccaccatcaattgagctcaaagaatttatggaggtt
gaagaaggaactgatgtcaacatagtggccaaaattaaaggtgtgccattcccaacacta
acctggtttaaagcgcctccaaagaagcctgataacaaagaacctgttgtctatgacacc
cacgtcaacaaagtggtggtggatgatacttgcaccttagttattccacagtctcgccgg
agtgacactggcttatatactatcacagccgtgaataacctgggaacagcatcaaaggag
atgagactgaatgtccttggtcgtcccggccctccagtgggacccataaagtttgaatct
atttcagcagatcaaatgacaatatcttggcttccacctaaagatgacggtgggtctaag
attacaaactatgtaattgagaaaagagaacctaacaggaagacctgggtgcacgtcacc
agtgaacctacagagtgcatgtacacaattcccaaattgcttgaaggccatgaatatgta
ttccgaatcatggcccagaataaatatggcattggcgagcctcttgacagtgaacctgaa
acagcaagaaacctcttttctgtccctggagcaccagataaaccaacagttagcagcgtg
actcgtaattccatgactgtcaactgggaagagccagaatatgatggaggctctcctgtg
acaggatactggctagaaatgaaagataccacttcaaagagatggaagagagttaatcga
gatcctattaaagccatgactttgggtgtttcttataaagtgactggtcttatcgaaggt
tctgattatcaattccgggtatacgcgatcaatgctgctggggtgggtccagcaagtctg
ccatcagacccagtaactgctagagatccaattgcccctcctggtcctccatttcccaag
gtcacagactggactaaatcaactgcggatttggagtggtctcctccactaaaagatggt
ggatccagagtaactggatacattgttgaatataaagaagaaggaaaagaagaatgggaa
aaggctaaagataaagaagtgagaggaacaaaacttgttgtgacaggattaaaagaagga
gcattctacaaatttagagttagagcagtcaacattgccggcattggagaacctggagaa
gttacagatgccattgaaatgaaggacagacttgtgttacctgacgttcagctggatgcc
agcgtcagagacagaattgtggtccatgctggaggagtgatccggatcatcgcctatgtg
tctggaaagcctcctccaacgatcacatggaacatgaatgaaagagccttacctcaagaa
gccaacattgagaccacagccattagctcatccatggtcatcaagaattgccagaggagc
caccaaggcgtctattctcttcttgccaaaaatgcggcaggagaaagaaagaagaccatt
atcgttgacgtattagatgtgccaggtcctgttggaataccattcctgcctcacaaccta
accaacgactcctgcaaactgacatggttttctccagaagatgatggaggctctccaatc
accaattacgtcattgaaaagcgggaagctgaccgcaaagcatggacaccagtgacatgt
acagttacccgacaaaatgctaccgtccagggtctcattcaaggaaaagcctactttttc
cgaattgcagctgaaaatagcattggcatgggcccatttgttgagacaacagaggaactt
gtcatcagagatccaataactgtaccagagcgtcctgaagacctggaagtcaaagaagtt
actaaagattctgttactttgacttggaatcctcctaagtatgatggcggatcagaaatt
attaactatgtcctagaaagccgtctcattggaactgagaagttccacaaagttacaagt
gacaacttgcttagcagaaagtacactgttaaaggcttaaaagaaggtgatacctatgag
taccgtgtcagtgccgtcaatattgttggacaaggcaaaccatccttttgcaccaagcca
atcacttgcaaggatgagctggctcctccaacccttgaccttgacttcagagataagctc
acaattcgagttggtgaagcttttgccctcactggccgttactcaggcaaaccaaagcct
aaggttacttggttcaaagatgaagctgacgtgctagaagatgaccgcactcaaataaag
accactccaacaacacttgctctagagaagatcaaggccaaacgttctgattccggcaaa
tactgtgtggttgtggagaacagtacaggctctaggaaaggtttctgtcaagttaatgtt
gttgatcgtcctggaccaccagtaggaccggttatttttgatgaggtaaccaaagatcac
atgattatctcttggaagccacctttagatgatggaggcagtgaaattaccaattatatt
attgagaagaaggaggtgggcaaagacgtttggatgccggtgacatctgcatgtgctaaa
acaacatgcaaagttcctaaactgcttgaaggaaaagattatattttccgtatacacgcc
gaaaatttgtatggaataagtgatcctctggtgtctgattcaatgaaagccaaagatcgt
ttcagggttcctgatgcacccgaccagccaattgttacagaagttaccaaagactctgca
ttagttacatggaacaagccaaatgatggaggaaagcccatcacaaactacatcctggaa
aagagggaaactatgactaaacgatgggttcgagttaccaaagagcctatccacccatac
actaaatttagggttcctgaccttctagaagggtgttactatgaattccgagtttctgca
gaaaatgaaattggtattggagacccaagcccaccatccaaaccagtctgtgctaaagat
ccaattgctaaaccaagcccacctgttaatcctgaagcaatagatacaacatgtaattca
gttgatctaacttggcagccaccacgtcatgatggtgggagcaagattctgggttatatt
gttgagtaccagaaagttggagatgaagagtggaaaagagccaatcacactcctgagtca
tgtcctgaaactaaatataaagtcactggtctccgggatggtcaaagctataagttcaga
attagagcagtcaatgaagctggtgaatcggacccagctcatgttccggagccagtgcta
gtaaaagacagacttgaaccccctgagttgattcttgatgccaacatggcaagagaacaa
cacataagggttggtgatactctaagacttagtgccgtcatcaaaggagtgccattccca
aaagtaacttggaaaaaagaagacagagaggctccaactaaagcaagaattgatgttact
ccagttggtagcaagcttgaaattcgtaatgctgcccatgaagatggtggaatttattcc
ttaacagtggagaatccagctggttcaaaaactgtctcagtaaaagtacttgtattagat
aagcctggaccacctagagatctggaagtcagtgaaatcagaaaagattcttgctacctc
acttggaaggaaccattggatgatggtggttctgttgttacaaattatgtggttgagagg
agagatgttgccagcgcccagtggtcacctctttcaactacatcaaagaaaaagagtcac
ttggctaagcatcttaatgaaggcagtcagtatctcttccgagtagctgctgagaaccag
tatggacgtggtccttttgttgaaacacctaaacccatcaaggctgtggatcccctacat
cccccagggccaccgaagaacctacaccacgtagacgttgacaagaatgaagtctccctt
gtttggaataagccagatcgtgatggtggttctccaatcactggatatttggtggaatat
caagaagagggcaccgaagattggattaagttcaagactgtgacaaacttagagtgtgtt
gttactggactacaacaaggaaaaacctataaattccgtgtaaaagctgaaaatattgtg
ggtcttagtctccctgatacaactatcccaatagaatgtcaagaaaaactagtgcctcca
tctgtggaactggatgtgaaattaattgaaggccttgtggtaaaagctggaactacagtc
agattccctgccattataaggggtgtacctgttcctactgcaaagtggacaaccgatggg
agtgagattaaaacagatgatcactacacagttgaaactgacagctactcatcagtgctt
accattaagaactgcttaaggaaagacactggggaatatcaaatcacagtttccaatgca
gctggcagcaaaacagtagccgtccatcttactgttcttgatgttcctggtccaccaaca
ggtcctattaatattctggaagttacccctgaacatatgactatctcatggcagccacct
aaggatgatggaggaagccctgtgataaattatatcgttgagaaaaaagatacaaggaaa
gacacgtggggtgttgtctcttcaggaagcagtaagacaaagctgaaagtcccacatcta
caaaagggttttgaatatgtcttccgagttagagcagagaataagatgggtgttggtcct
ccccttgactccgtacctactgttgctaaacacaagtttagtcctccatctcctcctggt
aaaccagtggttactgacataactgaaaatgctgcaacagtgtcttggactctgcctaaa
tctgatggtggcagtcctataactggttactatgtggaacgtcgagaaataactggcaaa
tgggtgagggtcaacaaaacacctataactgagctgaagtatacagtgactggactctat
gacggaaatacatatgagtttagagtttttgctgaaaatcttgcagggctaagcagtcca
tccccaagttctgacccaataaaagcttgccgacccatcaaaccacctggaccacctatt
aatcctaaactgaaagacaagaccagagaaacagctgacttggtgtggacaaagcctctc
agtgacggtggtagccccattctaggctatgtagtggaatgtcagaaacctggtacagca
caatggaacaggattaataaagatgaactcattaggcaatgtgcctttagggtacctggt
ctaattgaaggaaatgaatacagattccgtataaaggcagctaatattgtgggggaggga
gagccaagagaactagcagaatctgtgattgcaaaagacatccttcatcctccagaagta
gaacttgatgttacttgtcgtgatgttattactgttagagtgggccaaactatccgcatt
cttgctcgagtcaaaggcagacctgaaccagacataacttggtccaaggaaggcaaagca
ttggtccgagaaaagcgagttgacataattcacgatctacctcgcgctgagttacaaatt
aaagaagctattagagctgatcatggcaagtatatcatctcagctaagaacagcagtgga
catgcccaaggttccactatcgttaatgtccttgacagacccgggccttgccagaattta
agggttagcaatgtaactaaagagaactgtacgattgcttgggaaaacccactagataat
ggtggctcagaaataacaaatttcatagtagaataccgcaaacccaacgagaaaggctgg
tcaattgttgcttcagatgtcactaagcgattaatcaaggccaaccttttagccaacaat
gaatactatttccgagtttgtgcagagaataaagtaggtgttgggccaaccattgaaaca
aaaactccaattctggctattaaccctattgatagaccaggtgagcctgaaaaccttcat
attgcagacaaaggaaagacatttgtctatctaaagtggcggcggcctgactatgacggt
ggtagcccaaatctatcatatcatgttgagaggaggctgaagggctctgcagactgggaa
agagtgcacaaaggcagcattaaagaaacccactacatggttgacaagtgtgttgaaaac
cagatttatgagtttagagtgcaaacaaagaatgaaggtggggaaagtgactgggtaaag
acagaggaagttgttgtgaaggaagacttacagaaaccagtacttgagctgaaattaagt
ggtgtgctaactgtcaaagcaggggacaccattagacttgaggcaggtgttagaggcaaa
ccatttccagaagttttatggaccaaggataaagatgctacggacttaacaagatcaccg
agggtcaagattgataccagtgctgattcatctagattttctcttaccaaagcaaagcga
agtgatggtggtaaatatgtaattacagcaactaacacagctggcagttttgtggcctat
gccactgtcaatgttctagataagcctggtcctgtaagaaatctgaaaattactgatgtg
tccagtgataggtgtactatttgctgggatccaccagaagatgacggcggctgtgaaatc
caaaattatattctagaaaaatgtgagagtaagcgaatggtttggtctacctattctgct
actgtcttaacaactggtgctacggtaacacgcctcatagaaggaaatgaatacattttc
agagtccgtgcagaaaataaaataggcacagggcctccaacggaaagtaaaccggtcatt
gcaaaaaccaaatatgatagacctggtcgccctgatcccccagaagtcactaaagtaagc
aaagaagagatgactgtggtttggactccacctgaatatgatggtgggaagtccatcaca
ggatactttttggagaaaaaggaaaaacatggaacacgatgggtccctgttaacaagagt
gcaatccccgagagacgtctgaaagtacagaatctcctcccaggacatgaatatcagttc
cgtgtcaaggcagaaaatgaaattggaattggagaaccaagcttgccatcaaaaccagta
gtggcaaaagaccccatagaaccacctggtccaccaaccaatctcaaagtggttgatacg
accaaaagttctataacccttgcatggggaaaaccggtgtatgatggtggcgcgccgata
attggatatgttgtggaaatgagaccaaaaagaccagatatgtcacctgatgaaggctgg
aaaagatgtaatgcggcagcacagcttgttcgcatggaattcactgtcaccagcttggat
gaaaaccaggaatacgagttcagggtgtgtgcccaaaaccaggttggcattgggcgccct
gcagaactaaaggatgctattaaacctaaagaaatcctagaacctccggagattgatttg
gatgccagcatgagaaaactggtcacagtgagagcaggatgccctattcgactatttgcc
ataataagagggcgaccagcccctaaagtcacttggcgaaaagtgggtatcgataatgtc
gtcagaaaaggacaagtcgatctggttgacactatggccttccttgtcatccccaattct
acccgtgatgactcaggaaaatattccttgacgcttgtaaacccggcaggagaaaaggca
gtgtttgtgaacgtcagagtattagatactcctggacctgtgtctgatttaaaagtttca
gatgtcactaaaacatcatgccacatttcctggggccctcctgagaacgatggtgggagc
caagtgacacattatattgtggagaaacgtgaggccgacagaaagacatggtcaactgtt
accccggaagttaagaaaacaagcttccaagtcaccaatcttgtccctgggaatgagtat
ttcttcagagtaactgctgtcaatgagtatggccctggtgtcccaacagacgtccccaaa
ccagtgcttgcatctgatccgctctgtgagccggatcccccaaggaaactagaagtgact
gaaatgacaaagaacagcgctgcattagcctggttaccacccttgcgtgatggaggcgct
aagatcgatggctatatcattagttacagagaagaagagcagcctgcagatcgctggacg
gagtactcagtggtgaaagacctcagccttgttgtcactggcctaaaggaaggaaagaaa
tataaatttagagtagtggccagaaatgctgttggagtcagtttgccaagagaaactgaa
ggagtgtacgaagcgaaagaacagctgttgccaccaaagatccttatgccagagcaaatt
actatcaaagctgggaagaaactccgaattgaagcccatgtgtatggaaagcctcatccg
acctgtaaatggaaaaaaggagaagatgaagttgtcacatccagccacttggcagtgcat
aaagcagacaattcttcaattctgatcataaaagatgttactaggaaagacagtggttac
tatagcctcacagcagagaacagttctggaacagacactcagaaaatcaaagtcattgtc
atggatgctcccgggcctcctcagcctccatttgacatttctgatatagacgccgatgct
tgcaccctgtcgtggcacatccctctggaggatggaggcagtagcatcaccaattacata
gtggagaagtgtgacgtgagccgaggtgattgggtgacagctctagcttcagtgacaaaa
acttcctgcagagttggaaaactgatccccgggcaggagtacatcttccgagtccgtgct
gaaaatcgattcggcatttcagagcctctcacatctccaaagatgctggctaagttccca
tttggtgttcctagtgaaccaaagaatgcacgagtcactaaagtcaacaaagactgcata
tttgtggcatgggacagaccagacagtgatggagggagccccattaccggttacctgatt
gaacgcaaagaaagaaacagtttgctctgggtgaaagctaatgatactcctgtccggtca
actgaatatccttgtgcaggccttgtagaaggtcttgagtattcattcagaatatatgcc
ctaaacaaagctggatccagcccacctagcaaaccaacagaatacgtaactgcaagaatg
ccggttgatcctcctggaaagcctgaagttattgatgttaccaagaatacggtatccctt
atctgggctcgtccgaagcatgatggaggcagcaaaattattggctatttcgtagaagct
tgcaagcttcctggtgataagtgggtacggtgcaatactacacctcaccagattccccag
gaagagtacacagttactggcttagaagagaatgctcagtatcaatttagagcaattgcc
aagactgcagtaaacattagccagccttcggaaccttctgatccagtgaccatcgtcgca
gaaaatgttcctcccagaatagacctgagtgtggctatgaaatctttgcttactgtaaaa
gctggaactaatgtttgcctggatgctactgtttttggtaaaccaatgccaacagtctcc
tggaagaaggaaggcacactgctacaaccagcagaaggcataaagatggccatgaagcga
aacctgtgcaccctggagctgttcagtgtgaacagaaaggactcaggagactataccatt
actgctgaaaattcaagtggttccaaatcagccaccattaagcttaaagtgttagataaa
ccaggtcctccagcatctgttaaaatcaacaaaatgtattcagatcgtgcaatgctttct
tgggaaccacctcttgaagacggaggctcagaaatcaccaactatattgttgacaaacgt
gaaacaagcagacccaactgggcacaagtctctgctactgtgcccatcaccagctgcagc
gtggagaaactcatagagggccatgagtatcagttccgaatttgtgctgaaaataaatat
ggagtgggcgacccgatcttcactgaaccagcagttgctaaaaacccatatgacccacct
ggacgctgtgatcctcctgttattagcaacatcaccaaagatcatatgacagtaagctgg
aaaccgccagcagatgatggcggctcacccatcactggctatttggtggaaaagcgggaa
acccaggcagtaaactggactaaggtcaacagaaagcctgttatagaaagaacaataaaa
gcaacaggtctccaagaaggcaccgaatacgagttccgagttacagcaataaataaggct
ggaccaggcaaacccagcgatgcatccaaagctgtttatgcccaggaccctctctatcct
cctggcccaccagcttttcctaaagtatatgatacaacacgtagctccgtgagtctatct
tggggcaagccagcctatgacggtggtagccctatcattggttaccttgttgaagtaaaa
cgagctgactctgataactgggtgaggtgcaatttaccacagaagctacagaagacccgc
tttgaggttaccggcctgctggaaaacacagagtatcaattccgcgtgtatgccgtcaat
aaggttggatacagtgaccccagtgatgtgccagacaaacattgtcccaaggacatctta
attccacctgagggagaacttgatgccgatttgaggaaaacactcatattacgtgctgga
gttacaatgagactgtatgtaccagtaaaaggacgtccacctccaaagataacttggtct
aaaccaaatgtcaatctaagagaaaggattggactggacataaagtcaactgactttgac
actttcttgcgctgtgaaaatgtaaacaaatatgatgcaggaaaatatatcttgactctg
gagaacagctgtggtaaaaaggagtataccatcgtagtgaaagtgctcgatactcctggg
ccacccgtcaatgtgactgttaaggaaatatccaaagattctgcttatattacctgggat
cctcccattattgatggtggaagccctatcataaattatgtggtagaaaaacgtgatgca
gagaggaagtcctggtctacagtgacaactgagtgctcaaaaacaagcttcagagtatcg
aacttggaggagggaaaatcctacttcttcagggtgtttgctgaaaacgagtatggcatt
ggtgatcccggtgaaacacgtgatgccgtcaaagcttctgaaacccctggaccagttgtg
gacctgaaagtgacgtctgtaactaagtcatcttgtagcataggctggaaaaagcctcgc
agtgatggtggaagtcgaataattggatatgtggttgatttcttgaccgaagaaaataag
tggcaacgagttatgaaatcagcaagcttacagtactccacaaaagatttgactgaaggg
aaggaatataccttcagagtgagtgctgagaatgaaaatggagaaggaaccccaagtgaa
atcactgctgtggcaaaggatgatgttgtggctcctgaccttgacttaaaggatctacct
gatttgtgctacttggctaaagaaaacagcaacttccgtcttaagatccccataaaaggc
aagccagctccatcagtatcctggaagaaaggagaagatcctctagcaactgacacaaga
gtcagtgttgagtcatctgcagtcaacacaactcttgtagtatatgattgccaaaaatct
gatgctggaaaatacacaatcacactgaaaaatgttgctggcaccaaggaaggaactctc
tctataaaagttgttggcaagcctggcatccccactgggccaatcaaatttgaggaagtc
acagcagaagccataaccttaaagtggggtcctccaaaggacgatggaggttctgaaatc
accaactatatcctagagaagagagattctgtaaacaacaagtgggtgacctgtgcctca
gctgtccagaaaaccacatttagagtaaccagacttcacgagggtatggaatacaccttc
agggtcagtgccgaaaataaatacggtgtaggagagggcctgaaatcggagccaattgtt
gctaaacatccattcgatgtgcctgatgctcccccacctcccaatattgtggatgtcaga
catgattcagtatctctaacttggactgaccccaggaaaaccggtggctctccaattaca
gggtatcatattgagttcaaggaaagaaacagcctcttgtggaagagagctaacaagact
cctattaggatgaaagacttcaaagtgacaggattaactgaaggccttgaatatgaattc
cgagtcatggctatcaatttagcaggagtaggaaagccaagcctgccatcagagccagtt
gtggcacttgatccaattgatcctcctggcaaacctgaggttattaatgtaacaaggaat
tcagtgactctcatttggactgaacccaaatatgatggtggtcataaattgactggctat
atagtggagaagcgggatctaccctctaaatcttggacgaaagccaatcatgttaatgtc
ccagattgtgcctttactgtaactgaccttgttgagggtggaaaatatgaattcagaatt
agagcaaaaaatacagcaggtgccatcagtgctccatcagagagtacaggaaccattatt
tgcaaggatgaatatgaggcgccaaccattgtccttgatcccacaataaaagatggacta
acaattaaagcaggagataccattattttgagtgccattagcattcttggcaagcccctt
ccaaagtcaagttggtccagggcaggaaaagacattagaccatcagatatcgttcagata
tcttcgactccaacatcttccatgcttactgtcaagtatgccactagaaaagatgctggt
gaatacaccatcactgctaccaatccttttggcacaaaggaggaacatgtgaaggtaata
gtccttgatgtacctggtcctccaggtcccattgaaatcagtaatgtttctgctgaaaaa
gcaacacttacatggacacctcctttggaagacggtggctcaccaattaagtcctatatt
cttgaaaagagagaaaccagccgacttttgtggacagtcgttgctgaagatattcagtct
tgcaggcatgtggcaaccaaacttatccaaggaaatgagtacatcttccgggtctcagct
gtaaaccaatatggcaaaggagaacctgtgcagtccgaacctgtcaaaatggtagacaga
tttggtccccctggccctcctggaaaaccagagatttcaaatgtcactaaaaacaccgcc
actgtcagttggaaaagaccaactgatgatggtggcagtgagatcacgggatatcatgta
gaaaggagagaaaagaaaagtttgcgatgggtgagagcaaccaagacaccagtttctgat
ctcagatgcaaagtaacaggactgcaagaaggaaacacctacgaattccgtgtcagtgca
gaaaacaaagcaggagttggtccacctagtgatgcttcaaatcctgttctaatgaaagat
gtagcatatcccccaggaccaccttcgaatgcacgtgtcactgatactaccaagaaatct
gcttctttggcatggggcaagcctcattatgatggtggacttgaaatcactggctacgtc
gtggagcatcaaaaagtaggagatgaggcctggataaaagatacaacaggaactgccctc
agaatcactgagtttgttgtccctgatcttcagactaaagaaaaatacaattttagaatc
agtgccatcaatgacgcaggtgttggggagccagcagtgattccagatgttgaaattgta
gaacgagaaatggctcctgatttcgaactagatgctgagcttcgaagaacacttgttgtt
cgagcaggactcagtattagaatatttgtgccaattaaaggtcgtcctgctcctgaagtg
acatggaccaaagatgacatcaaccttaaaaacagagctaacattgaaaatacagaatca
tttactcttctgattatcccagaatgtaacagatatgacactggtaaatttgtgatgacc
atcgaaaaccctgctgggaagaaaagtggcttcgttaacgtcagagtcttggatacacca
ggaccagtccttaacctgaagcctactgacatcacaaaggacagtgtcaccctccactgg
gacctccctctgatagatgggggctcacgtataacaaactatattgtggagaaacgagaa
gcaacacggaaatcttactccacagtcaccactaagtgccataaatgcacatataaagtt
accggcttgtctgaaggatgtgaatacttcttcagagtgatggcagaaaatgaatatgga
atcggcgagccaacagaaacaacagaacctgtaaaagcctctgaagcaccatcaccacca
gacagtcttaacattatggacataactaagagcacagtgagcctggcgtggcctaaacca
aaacatgatggtggcagtaggatcactggctacgtgattgaagcccagagaaaaggctct
gaccagtggacccacatcacaaccgtgaagggattggaatgtgtcgtgaggaatctaact
gaaggggaagaatataccttccaagtgatggcagtgaacagcgcagggagaagtgcccct
agagaaagcagacctgtcattgtcaaggagcagacaatgcttccagaactggacctccgt
ggcatttatcagaaattagtcattgccaaagctggtgacaacatcaaagttgaaattcca
gtgcttggtcgaccaaagcccacagttacgtggaaaaaaggagaccaaatacttaaacag
acacagagagttaattttgaaaacacagcaacctcaaccatcttaaatatcaacgagtgt
gtgagaagtgacagcgggccctatcctttaacagcaaagaacattgtaggagaggttggt
gatgtcatcaccattcaagtccatgatatcccagggccacctactggaccaatcaaattc
gatgaagtttcatctgattttgtaaccttctcttgggacccacctgagaatgacggaggt
gtaccaataagcaactatgtagtagaaatgcgacagactgacagtactacatgggtcgag
ttagcaaccaccgttatacgcactacctataaagccactcgtcttactaccggaatggag
tatcaattccgggttaaagctcaaaacagatacggagttggaccaggcatcacatcagca
tctatagttgctaattatccgtttaaggttcctgggcctccaggtacccctcaggtaact
gcagttaccaaagattcaataacaattagctggcatgagcctctttctgatggtggaagc
cccattttaggatatcacattgaaagaaaagaacgaaatggtattctctgggagactgtg
agcaaagcattagtaccaggcaacattttcaaatcaagtggacttacagatggtattgct
tatgaattccgagtgattgcagaaaacatggcaggcaaaagcaagccaagcaagccatct
gaacctgcatttgctttggatcccattgacccacctgggaaaccagttcctctaaatatt
actagacacacagtgacacttaaatgggctaagcctgaatatactggaggctttaaaatt
accagttatatagttgaaaagagagatcttcctaacggacggtggctaaaggccaacttc
agcaacattttggagaacgaatttacagtcagtggcctaacagaagatgctgcatatgaa
ttccgtgtgattgccaaaaatgctgctggggctattagtccaccatctgagccatcagat
gctatcacatgcagggatgacattgaagcaccaaggataatggtggacgttaaatttaag
gacacagttatattaaaagcaggcgaagcatttaagctggaagctgatgtttcaggtcgc
ccacctccaacaatgacatggaccaaagatggaaaagagcttgaaggcacagcaaaatta
gaaattaaaattgcagatttctctactaatctggtaaacaaggattcatcaagaagggat
ggtggtgcctatacccttactgcgactaatcctggtggttttgctaaacatattttcaat
gtcaaagttcttgatagaccaggcccacctgaaggacctttagctgtatctgaagtaacg
tcagaaaaatgtgtgttgtcatggttgcctccactagatgatggaggtgccaaaattgag
cattatgtagttcagaaacgtgaaactagcagattggcatggacaaatgtagcctcagaa
gttcaagtaacaaaactaaaggtcactaaactcttgaaaggtaatgaatacatattccgt
gtcatggctgtaaataaatatggagttggagagccactggaatcagagcctgtgcttgca
gtagatccttttggacgccctgatccacccaaaaaccctgaagttacagctattactaaa
gattcaatggttgtctgctggggacatcctgactctgatggcggaagtgaaatcatcaat
tatatcgtggaacggcgtgataaggccgggcaacgctgggtgaaatgcaacaaaagaact
cttaccgatttaagatataaagtgtctggactgacagagggacatgaatatgagttcagg
attatggctgaaaacgctgctggaattagtgcaccaagtcctaccagtccgttttataaa
gcttgtgatactgtgtataaacctggcccaccaggtaacccacgtgttctggatacaagc
agatcatccatttcaattgcttggaataaacctatctatgatggtggctccgaaatcact
gggtacatggtcgagattgccctgccagaggaagatgaatggaagattgtcactccacca
gctgggctcaaggcaacttcttacaccatcaccaacctcacagagaatcaggaatataaa
atccgcatctatgccatgaattctgaaggaattggggaacctgcacttgttcctggaact
cccaaggctgaagagaggatgctgcctccagagattgaactggatgctgacctgcgcaaa
gttgttactataagagcttgctgtaccctgagactttttgttccaatcaaaggaaggcct
gcacctgaggtgaagtggacccgggaacatggagaatctttagataaagctagcattgaa
tccaccagctcttatacgctgcttattgttggaaatgtaaacagattcgacagtggcaaa
tatatcctaactgtagaaaacagctcaggcagcaagtcggcatttgtcaatgtcagggta
ctagatacaccaggccctccacaggatctcaaggtaaaggaggtcactaaaacatctgtc
acattgacatgggagcctcctctccttgacggaggttcaaaaataaagaactatattgtt
gaaaagcgggaatcaacaagaaaggcatattcaactgttgcaacaaattgccacaagact
tcctggaaggtagaccagcttcaagaaggctgcagttactatttcagggttctcgctgaa
aatgaatatggcatcgggctgcctgctgaaaccgcagaatctgtgaaagcatcagaacga
cctcttcctccaggaaaaataactttggtggatgtcacaagaaacagcgtgtcactctca
tgggagaaaccagagcatgatggaggcagtcgaattctaggttacattgtagagatgcag
agcaaaggcagtgacaaatgggtcacatgtgccacagtcaaagtcaccgaagccactata
actggattaattcagggtgaagaatactctttccgtgtttcagctcagaatgaaaagggc
atcagtgatcctagacaactgagtgtgccagtaattgccaaggatcttgtcattccacca
gccttcaaactccttttcaatactttcactgtactggcaggtgaagacctaaaagttgat
gttccattcattggacgccctacaccagctgtaacatggcataaagatgatgtgccactg
aaacagacaactagagtaaacgcagagagcacagaaaataattcactactgacaataaag
gaagcctgccgagaagatgttggacattacacagttaaactgactaactcagctggtgaa
gccactgaaacccttaacattattgttcttgacaaaccagggcctccaactggaccagtt
aaaatggatgaagtgacagctgatagtattactctttcctggggcccacctaagtatgat
gggggaagttctatcaataattacattgtagaaaaacgagacacttccacaactgtctgg
caaattgtgtcagctactgttgcaaggacaacgataaaggcttccagattaaagactgga
tgtgaatatcagtttaggattgcagctgaaaacagatatggaaagagtacctacctcact
tcagagcctattgtagcccagtatccattcaaagttcctggtcctcctgggacaccattc
gtaaccctctcctccaaggacagcatggaagtacagtggaatgagccagtcagtgatgga
ggcagcaaagtcattggctatcatctagaacgcaaggaaagaaatagcatcctctgggtt
aagttgaataaaacacctattcctcacaccagatttaaaacaactggcctcgatgaaggc
attgaatatgaatttagagtctccgcagaaaatatcgtgggcatcggcaagccaagtaaa
gtgtcagaatgctatgtagcgcgtgacccatgtgatccaccagggcggccagaggcaatc
atggtcacacggaattctgtgactcttcagtggaagaaacccacttatgatggtggaagc
aagatcactggttatgttgttgaaaagaaagaattgcctgacggccgttggatgaaagcc
agttttacaaatgttattgacactcaatttgaagtaactggcctagttgaagatcataga
tatgagttccgggttatagctcgaaatgctgcaggagtgtttagtgagccttcagaaagc
acaggagcaataacagcaagagatgaggtagatccaccacgaataagtatggatccaaaa
tataaagacacaattgtggttcatgctggtgagttattcaggattgatgcagatatttat
ggcaaaccaataccaaccattcaatggataaaaggtgatcaggagctttcaaatacagct
cgattagaaataaagagcactgactttgccaccagtctcagtgtaaaggatgcagtacgc
atcgacagtggaaattacatattgaaggccaaaaatgttgcaggagagagatcagttacc
gtaaatgttaaagttcttgatagaccagggccacctgaaggacctgttgttatatcagga
gttactgcagaaaaatgcactctagcttggaaacccccactacaggacggtgggagtgac
atcataaattatattgtggaaagaagagaaaccagccgcttagtttggactgtggttgat
gccaatgtgcaaactctcagctgcaaggttactaagcttctggaaggcaatgaatatact
ttccgtataatggctgtaaacaaatatggtgttggcgaacctcttgaatctgagccagta
atggccaagaatccatttgtagtgccagatgcaccaaaggctccagaaatcaccacagtg
accaaggactcaatgattgttgtatgggaaaggccagcatctgacggtggcagtgaaata
cttggatatgttcttgaaaaacgggataaggagggcgttcgatggacaagatgccacaaa
cgtctgattggggaattgcgcttgagagtaactggactcttagaaaatcacaattatgaa
ttcagagtctcagccgagaacgccgctggacttagtgaaccaagcccaccttccgcttac
caaaaggcttgtgatcctatttataaaccaggacctccaaacaatcccaaagtcatagat
attaccaggtcttctgtcttcctttcttggagcaaaccaatatatgacggtggctgtgaa
atccaaggatacattgttgaaaaatgtgatgtgagtgttggcgaatggacaatgtgcact
ccaccaactggaatcaataaaacaaatatagaagtagagaagctgttggaaaagcatgaa
tacaacttccgtatctgtgctgttaataaagctggagttggagaacatgctgatgtccct
ggacctgttatagttgaagaaaaactggaagccccagacattgatcttgacctagaacta
aggaaaattataaatataagggcaggtggctctttaaggttatttgttcctattaaaggt
cgtcctacaccagaagttaaatgggggaagatggatggtgaaatccgagatgcagctata
attgatgtcactagcagtttcacctctcttgttctggacaatgtcaaccgatatgatagt
ggaaagtacactctcacattagaaaacagcagtggaacaaagtctgcctttgttaccgtg
agggtcctggacacaccaagtccacctgttaacctgaaagtcacagaaatcactaaagac
tcggtttcaattacgtgggaaccacctttgttggatgggggatccaaaatcaaaaattac
attgttgagaaacgtgaagccacaagaaaatcgtatgctgcagttgtaacaaattgccat
aagaattcttggaaaatcgaccaactccaagaaggttgcagttattactttagagtcaca
gctgagaacgagtttggtattggccttcccgcccacactgctgatccagttaaggttgca
gaagtcccacaacctccaggaaaaataactgtggatgatgtcaccagaaatagtgtctcc
ttgagttggacaaagcctgaacatgatggtggaagtaaaatcattcagtatattgtggaa
atgcaagctaagcacagtgagaaatggtcagagtgtgctcgtgtcaagtccctcgaagca
gtaattaccaacctaactcagggagaagaatatctttttagagttgttgctgtaaatgaa
aaggggagaagtgatcctaggtcccttgcagttccaatagttgccaaagatctggtcatt
gagccagatgtaagacctgcattccacagttatagtgtacaggttggccaggatttgaaa
atagaagtgccaatttctggacgtcctaagccaaccgttacctggactaaggacgatctt
cctctgaagcagactacaagaatcaatgttactgattcacttgaccttactgtactcagt
attaaagaaactcataaggatgatggtggacattatggaatcacggttgctaatgttgtt
ggtcagaaaacagcatctattgaaattataactctagataaacctgatcctccaaaagga
cctgttaaattcgatgaagtcagctctgaaagtattacattatcttggaaccctccgcta
tatacagggggctgccagatcaccaactatattgttcagaaaagagatacaaccaccaca
gtatgggatactgtttctgctactgttgccagaactacactcaaagtgaccaaactgaaa
actggtacagaataccaattcagaatattcgctgaaaacagatatggacaaagctttgcc
ttggagtctgatccaattgtagctcaatatccctacaaagaaccagggcctccaggcaca
ccatttgtcacaaccacttccaaagactccatggttgtacagtggcatgaaccaatcaat
aatggtggaagcccagtcataggttaccaccttgagaaaaaggaaagaaatagtattttg
tggacaaaagtcaacaaatctattattcatgacacccagtttaaagcagtcaatcttgaa
gaaggcattgaatatgaattcagagtttatgctgaaaatattgttggtgtaggcaaagta
agcaagaattccgaatgctatgtagccagagatccctgtgacccaccaggaaccccagaa
gcaataatggttaaaagaaatgaaatcactttacaatggaccaaacctgcatatgatggt
ggaagtatgatcacgggttacattgtagagaaacgtgatttgcctgagggtcgttggatg
aaagctagcttcacaaatgtcattgaaactcaatttactgtgtcaggtcttactgaagat
caaagatatgaattcagagttattgcaaagaatgcagctggtacaataagtaaaccctcc
gacagtactggaccaataactgccaaggatgaggttgaacttccaagaatttcaatggat
ccaaaattcagagacacaattgtggtaaatgctggagaaacattcaggcttgaggctgat
gttcatggaaagcccctacctaccattgagtggttaagaggagataaggaaattgaagaa
tctgctaggtgtgaaataaagaacacagatttcaaagctttacttatcgtaaaggatgcc
attagaattgatggtggacagtatattttaagagcttccaatgttgcaggttctaagtca
ttcccagtaaatgtcaaagtattagatagaccaggacctccagaagggccagtccaggtt
accggagtcacttctgaaaaatgcaatttaacatggtctccaccacttcaagatggtggc
agtgacatttctcactatgttgttgaaaagagagaaacgagtcgacttgcctggactgtt
gttgcttcagaagttgtgaccaactccctgaaaattaccaaactcttagaagggaatgaa
tatattttccgtataatggctgtcaacaaatatggggttggagagcctttggaatctgca
ccagtactaatgaaaaatccatttgtgcttcctggaccaccaaaaagcttggaagtcaca
aacactgccaaggactccatgactgtctgttggaaccgtccagatagtgatggtggaagt
gagattattggttacattgtagagaaaagagacagaagtggcattaggtggataaaatgt
aataaacgccgcattacagatttgcgcctaagagtaacaggattaacagaagatcatgag
tacgaattcagagtctctgcagaaaatgctgctggagttggagaaccgagtccagctaca
gtttattataaggcttgcgatcctgtgttcaaacctggcccacccatcaatgcacatgtt
gtagacaccactaaaaattcaattacacttacctggggtaaacccatctatgatggtggc
agtgagatcctgggatatgtagtagaaatatgtaaagcagatgaagaagaatggcaaata
gttactccacagactggcctgaaagccactcgatttgaaatttcaaaactcactgaacac
caagagtacaaaatacgagtctgtgccctcaataaagttggtttaggtgaggctacgtca
gttcctggtactgtgaaaccagaagataaactcgaagcacctgaactggaccttgactct
gaattaaggaaaggaattgttgtaagagctggtggatctgccagaattcacattccattc
aaaggtcgtccaacacctgacatcacttggtctcgagaggaaggtgaattcacagataag
gtccaaattgaaaagggagtaaactatacccaactatcaatagataactgtgatagaaat
gatgctggaaaatacattctcaagctggaaaatagcagtggatctaaatctgcttttgta
actgtgaaagttcttgacactccaggaccaccacagaatttggcagtcaaagaagtgaaa
aaagattctgtcattcttgtatgggaaccacccatgattgatgggggcgcaaaggtcaag
aactatgttattgacaaacgtgagtcaaccagaaaagcatatgctaatgtgagtaataaa
tgcagcaaaacaagccttaaagttgagaatcttacagaaggggccatttattactttaga
gttatggctgaaaatgaatttggagttggcgttccagtggaaactgttgatgctgtgaaa
gctgctgaacctccttccccaccaggaaaggttacactcactgatgtgtcccagaccagt
gcatcgcttatgtgggagaaacctgaacatgatggtgggagcagaatcctggggtatgtt
gttgaaatgcagcccaaaggaactgaaaaatggagtgttgtggctgaatccaaagtctgt
aatgcagttattactggtttgagttctggacaagaatatcacttccgtgtcaaggcttat
aatgagaaaggaagaagcgatccaagagtgcttggtgttcctgtcatagccaaggacttg
accataccgcctagtttcaagttaccatttaacacatatagtgtccaagctggagaagat
cttaaaattgaaattccagttattggccgaccaagacctgaaatttcatgggtcaaagat
ggtgagcctcttaaacagacaacaagagtaaatgttgaggaaacagctaattcaactatt
ttgcacattaaagaaactaacaaagatgattttggaaagtataccataacagcaacaaat
attgccggtacagcaacagaaaatctcagcattattgttttggaaaagcctggacctcca
gttggaccagttcggtttgatgaagttagtgcagactttgtggtcatatcttgggaacct
ccagcctatactggtggctgccaaataagcaactacattgtagagaagcgagatacaacc
accaccacttggcaaacggtatcagcaacagttgcaagaacaacaattaaaatagccaaa
ctgaaaacaggcactgagtaccagtttagaatttttgcagaaaacaggtatggaaaaagt
acccacctggattctaaaccagttattgtacaatatccatttaaagaacctggaccacct
ggaactccttttgtgacatcagtctcaaaagatcaaatgcttgtgcaatggcatgagcca
gttaatgacggaggtagtaaagttattggctaccatcttgaacagaaagaaaagaacagc
attttatggatcaaattaaataagactcccattccagacaccaaattcaaaacaactggc
cttgatgaaggcattgagtatgagttcagagtttctgctgaaaatattgttggcatcggc
aagcctagcaaagtgtcagaatgctttgttgcccgtgatccatgtgacccacctggtcgc
cctgaagccattgttattacaagaaacaatgtcacactgaaatggaagaaacctgcctat
gatggtggcagcaaaataacaggttatattgtagaaaagaaagacctacctgatggccgt
tggatgaaagccagctttaccaatgtattagaaactgaatttacagtgagtggacttgta
gaagaccaaagatacgaatttagagtaattgcaagaaatgcagcaggcaactttagtgaa
ccatctgaaagcactggtgccattactgcaagagatgaaattgatgcaccaaatgcctca
ctggatccaaaatataaagatgttatcgttgttcatgcaggagagacttttgtcctggaa
gctgatatccgcggcaaacccatacctgatattgtttggttaaaagacggaaaagagctt
gaagaaacagctgctaggatggaaattaagtctactattcagaaaacaactcttgttgtc
aaagactgtatacgtactgatggaggacaatatattctgaaactcagcaatgttggtggt
acaaagtctataccaatcactgtaaaggtacttgacaggccagggcctcctgaagggcct
ctgaaagtttctggggttactgctgaaaaatgttacttggcatggaacccacctttgcaa
gatggtggtgctaatatttcacattacatcattgaaaagagagagacaagcagactctca
tggacccaggtttcaactgaggtacaggcccttaactacaaagtcactaaacttcttcct
ggaaatgagtacattttccgtgtcatggctgtgaataaatatggagttggagagcctttg
gaatctgaacctgttatagctcgtaatccttataaaccaccaggtcctccttcaccacct
gaagtctcagcaatcaccaaagattctatggtagtaacgtgggcacgcccagtggatgat
ggaggtgctgaaattgagggatacattcttgaaaaacgagataaggaaggcgttagatgg
accaagtgcaacaagaaaacactaacagatctccgattcagggtaactgggcttaccgaa
ggtcattcctatgaattcagagttgctgctgaaaatgcagctggtgtgggtgaacccagc
gagccatctgttttctaccgtgcatgtgatgctttgtatccaccaggtccaccaagtaat
ccaaaagtgacagacacttccagatcttctgtctccctggcatggaataagccaatttat
gatggtggtgcccctgttaagggctacgttgttgaagtcaaagaagccactgctgatgaa
tggacgacttccactccaccaacaggattacaaggaaagcagttcacagtgaccaacctt
aaagaaaatactgaatataacttccgcatttgtgccatcaattctgaaggtgtaggtgaa
cctgcaactatacctggttcagttgttgctaaagacaggttagagccaccagaaatagaa
cttgatgctgatctcagaaagatggtcattctgcgtgcaagtgctactttacgcttattt
gtcactatcaaaggtcgaccagaacctgaagttaaatgggaaaaagccgaaggcattctc
actgagagggcccagattgaggtgaccagctcatacacaatgttggtgatcgataatgtt
accagatttgacagcggtcgatataatctgacactagaaaataacagtggctctaaaaca
gcttttgttaacgtcagagtccttgactcaccaagtgcccccgtgaatttgagtgtaaaa
gatgtgaagaaagactcggtgacattgtcttgggaaccaccacttatcgatggtggagcc
aaggttacaaactacattgtcgaaaaacgagaaactacaagaaaagcctatgctactgtt
acaaacaattgcactaagactacttttaaaattgaaaatctacaagaaggatgctcttac
tacttccgagtcttggcttgcaatgaatacgggattggtttgccagctgaaacaagtgaa
cccgttaaagcttctgaaccacccctcccacctggaagagtaactcttgttgacgtgacc
agtaacacagctacaattaagtgggagaaaccagaaagtgacggtggcagcaaaattact
ggttatgtggttgaaatgcagactaaagggagtgaaaaatggagcacttgcacacaagtt
aagactctagaagcaactatatctggcctaacttcaggagaagagtatatcttcagggta
gctgctgttaatgaaaaaggaagaagtgatccaagacaacttggagtgccagtaattgca
agggatattgaaataaagccttcagttgagcttcctttccatactttcaatgtaaaggct
agagaccaacttaagattgatgttccatataaaggaagacctcaagctactgtaagctgg
aaaaaagatggtcagactctaagagaaacaactagagtcaatgtttcttcttcaaagact
ataacatcactatctattaaggaagcctcaagagaagatgttggaacttacgaattatct
gtttcaaacagtgctggatccataacagttcctattactgtaattgtccttgacagacca
ggacctccaggacctatacatattgacgaggtcagttgtgacaatataaccatttcttgg
aatcctccagaatatgatggtggctgccaaattagcaattacatcgttgaaaagagagaa
accacttctacaacttggcatgtagtttcacaagcagttgcgagaacatctattaaaata
gttcgcctgacaacaggaagtgagtatcagttccgtgtctgtgcagaaaaccgctatgga
aagagcacctacagtgactctccagctgttgttgcagagtatccattcagccccccaggt
cctcctggtactcctaaagttgtgcatgccacgaaatctaccatgattgtaacctggcaa
gtgccagttaatgatggaggaagtcaagtaattggctatcaccttgagtataaagaaaga
agcagcattctttggtcaaaagcaaataaaatcctcattgctgatactcaaatgaaagtc
tctggccttgacgaaggactgatgtatgagtatcgtgtatatgctgagaatattgctgga
attggtaaatgcagcaagtcttgtgaaccagtccctgcaagagatccttgtgaccctcct
ggacaacctgaagtcacaaatatcacaagaaaatcagtgtcacttaaatggtctaagcca
cattatgacggtggagctaagatcacaggatacattattgaacgtagagaactaccagat
ggccggtggctgaagtgcaattttactaacgtacaagaaacatactttgaagtaactgaa
cttactgaagatcaacgttatgaattccgggtttttgcaaagaatgctgccgactctgtt
agtgaaccatctgaatccactggaccgattactgttaaagatgatgttgaggctccaaga
attatgatggatgtcaagttccgagatgttattgttgtcaaagctggagaggttcttaag
ataaatgcagacattgcagggcgacctctgccagtaatttcctgggccaaggatggtgta
gaaattgaagaaagagcaagaacagaaattgtctcaacggactataatactttgttaaca
gtgaaagactgtgttagacgagacactgggcaatacatactaacactgaagaatgttgca
ggaactcgttctgtggcagtcaattgcaaggtacttgataagcctggcccaccagccgga
ccacttgaaatatatggtctcactgctgagaaatgctctctttcctggggaccgccccaa
gaaaatggtggtgcagatattgactattacattgtagaaaaacgtgaaacaagccgcctt
gcatggacaatatgtgaaggagagttaaggacaacatcctgtaaagtaaccaagttactc
aaaggcaatgaatacatctttagagtaacaggtgttaataaatacggtgttggtgagccc
ctcgagagtgtggctgtaaaggcactagatccatttacagttccaagtccacccacatct
ttggaaattacctctgtgaccaaagattccatgacactttgctggtcaagacctgagagt
gatggaggtagtgaaatttctggatatataatagaaaggcgagagaaaaacagcgtacga
tgggtgcgtgtaaacaaaagaccagtttatgatctgagagtgaaatcaacaggacttcgg
gaaggatgtgaatatgagtatcaggtttatgcagaaaatgctgctggcctaagccttcca
agcgaagcctctcccttaattcgggcagaagatccagtgttcttaccatctcctccagct
aaacccaaaattgtggactcaggcaagacaaatataactattagctgggttaagccctta
tttgatggtggggccccagtaaccggatacactgtggaatataaaacgtctgatgaaact
gactggaaaactgccattcagaacttaagaggcacagaatatacaataagtggactaaca
acaggagctgaatacgttttcagagtaagatccatcaataaggtcggtgctagtgatccc
agtgatagctccgatccccagatagcaaaggaaagagaagaagaacctgtatttgatctt
gacagtgagatgaagaagaccttgattgtcaaggccggtgcctcatttactgtgactgtg
cctttccgaggaagaccagtacccaatgtctcgtggagtaagccagacactgacctccgc
actagagcctatattgattccacagactctcgtacatcacttactattgaaaatgccaac
agaaatgattctggaaaatacacattaacgattcagaatattttgagtgctgcttcgctc
accttagttgtcaaggttttagattctcctggacctccggctaatatttctgtacacgat
gtcaccaaagagtctgcagtgttatcctgggatgttcctgaaaatgatggtggagcacca
gtgaagaattaccacatagaaaaacgtgaggccagtaagaaagcatgggtctctgtgacc
aacaactgtaaccgcctctcctacaaagttaccaacttacaagaaggggcgatttactac
ttcagagtctctggacaaaacgagtttggtgttggtgtaccagctgaaacaaaggatgga
gtaaaaataacagaaaaaccaagcccacctgaaaaacttggagtaacaagtgtatccaag
gatagtgtttccctgacctggctgaagccagaacacgatggtggaagcagaatcgtacat
tatattgttgaagcactagaaaaaggacataaaaattggtttaaatgtgcagtggtcaag
tcaacccatcacgttgtttctggtctgagggagaattctgaatactttttccgggtgttt
gctgaaaatcaagctggtctgagtgacccaagagagcttctgcttcctgttcttattaag
gagcaactagaaccacctgaaatcgatatgaagaatttcccaagtcaaaccgtatatgtc
agagctggttcaaaccttaaagttgacattccaatttctggaaaaccactgcccaaagtg
accttatcaagagatggtgtccccctgaaagcaaccatgagatttaacactgaaattact
gctgagaacctcaccatcaatctcaaagaaagtgttgctgctgatgctggaagatatgag
atcactgctgccaactctagtggaacaacaaaaactttcattaacatcattgtcctggac
aggcctggtcccccaactggccctgttgttattagtgatataactgaagaaagtgtgact
ctcaaatgggagccacctaagtatgatggtggaagtcaggttaccaattatattgtactc
aagagagagacaagtactgcagtatggactgaagtgtccgcaacagttgcaagaaccacg
attaaagtcatgaaactgaccagaggagaagaataccaattccgcatcaaggcagaaaac
cgctttggcatcagcgatcacatagattcagcttgtgtggttgtcaaactcccatacaca
acacctggaccaccatctacaccatgggtcactaatgtcactcaggaaagcatcactgtg
agctggcatgaaccagtatccaacggaggcagtgcagttataggttatcacctggaaatg
aaagacagaaacagtattttatggcaaaaagtcaacaaaatgatcatccgcacaactcac
ttcaaagtcacaacaatcagtgctggacttatttatgaattcagagtatatgcagaaaat
gctgctggtgttggaaagcccagccatgcttccgaaccagtcctagccattgatgcctgt
gaacccccaagaaacatccgtatcactgatatttcaaagaactctgtcagcctttcatgg
caacaaccagcttttgatggaggaagcaagattacaggctacattgttgagagacgagac
cttccagatggcagatggaccaaggccagcttcaccaatgttattgagactcaattcatt
gtctctggcttgactcagaattctcagtacgaattccgtgtctttgctaggaatgccatt
ggttccatcagcaatccatccgaggttgtaggccccgttacatgcattgattcttatggt
ggacctgtaattgatttgcctctagaatatacagaagttgtcaaatacagagcaggtaca
tctgtgaagctcagagctggcatttctggcaaacctgagcctacaattgagtggtttaaa
gatgataaagagttacaaaccaatgcacttctgtgtgttgaaaataccactgaccttgcg
tctatactcatcaaagacgcaaatcgccttaatagtggaagatatgaattaaaactaagg
aatgccatgggctcagcttcagccaccatcagagtgcagatccttgacaaaccaggacct
ccaggtggaccaattgaatttaagacggtcactgctgaaaagatcactctgctctggcgg
cctccagtagatgatggcggtgcaaaaatcactcactacgttgtggaaaagcgtgaaaca
agccgcgttgtgtggtctatggtgtctgaaaatttggaagagtgcatcattaccaccacc
aaaattatcaaaggaaatgaatacgtcttccgggttcgcgctgtgaacaaatatggaatt
ggtgatccactggaatctgatccagtggtagcaaagaatgcatttgttacacctgggcct
ccaagcataccagaggtgacaaagattaccaagaattcaatgactgttgtctggaacagg
ccagttgcagatggtggtagtgaaataagtggctatttccttgaaaaacgagacaagaag
agtctaggatggtttaaagtactcaaggagtctatccgtgacaccagacagaaagtggca
ggactcacggaaaacagtgactatcaataccgagtttgtgctgtaaatgctgctggacag
ggtccattttcggaaccatctgacttctacaaagctgctgatcctattgatcctccaggc
ccaccagctaagataagaatcgcagattcaactaaatcatccatcactcttggctggagt
aaacctgtctatgatgggggcagtgctgtgactggatatgttgttgcaatgagacaagga
gaagaagaggaatggactgttgtctctaccaaaggagaagtcagaactacagaatatgtg
gtatctaacctgaaacctggagtcaattactatttccaggtatccgctgtaaactgtgct
ggacaaggagaacctatagaaatgactgagcctgtacaagccaaagatatacttgaggaa
ccagagatcgacctagatgtggctctcagaacctctattatagctaaagccggtgaagat
gtacatgtgttcataccgtttaaaggcagacctccacctactgtcacatggagaaaagat
gagaagaatcttggcagtgatgccagatatagcattcaaaacactgattcatcttcatta
ctcattattcctcaagtcactcgcaatgatacgggaaaatatattctcacaatagaaaat
ggagttggtcaaccaaagtcttcaactgtgagtgtcaaagtgcttgatacgccagccgcc
tgccagaaactacagattaaacatgtttctcaaggcacagtcacattgttctgggatcct
cctctcattgatggaggatctcccataattaattacatcattgaaaagagagatgccacc
aagagaacatggtcctcagtgtcacacaaatgttccagcacaacctttaaggtaaaagat
ttgtcagagaaaactccattcttcttcagagttctcgcagaaaatgaaattggaatcggg
gagccttgtgaaactacagagccagtgaaggctgctgaagtaccagctccaatacgtgat
ctctcagtgaaagattcaacaaagacatctgttaccctgagctggaccaagcctgacttt
gatggtggtagtgtcatcacagaatatgttgtggaaaggaaaggcaaaggtgaacaaaca
tggtcatatgctggcataagtaaaacatgtgaaattgaggttggccaacttaaggaactg
tcagaactggaattcagagtgtctgccaaaaatgagaaaggactgagtgatgctgtcact
attgggccagttacagtgaaagaacttgtaattacacctgaagttgacctgtcagaaatc
cctggggcgcaagtcgctgtgagaattgggcataatgtgcaccttgaattaccttacaaa
ggaaaacccaaaccatctatcagttggctgaaagatggtttgccattgaaagaaagtgaa
tatgttcgtttcagtaaaactgaaaacaaaattactttgagtattaagaatgtcaagaag
gaaaatggagggaaatacaccgttattcttgataatgcagtttgtagaacctcagttccc
attacaatcatcacacttggcccaccatcaaagcccaaagggcccgttcgatttgatgaa
atcaaggctgacagtgtcatcatgtcatgggatgtgcctgacgatgatggaggaggagaa
attacttgttacagcattgagaagcgggaagcttcacaaaaaaattggaagatggtgtgc
tcgagtgttgccaggacaactttcaaagttcctaatctagtcaaagatgctgaataccag
tttagagttagggcagaaaacagatacggagtcagccagccacttgtctcgaccatcatt
gtggcaaaacaccagttcaggattcctggccctccaggaaagccagttatatacaatgtg
acttctgatggaatgtcactaacctgggatgctccagtttatgacggtggtgcagaagtt
actgggttccatgttgaaaagaaagaaagaaatagcatcctctggcaaagaattaataca
tcaccaatatctggaagagaatacagagctactggactaatggaaggcctggattaccag
ttccgtgtatatgctgaaaattctgccggcctaagcgcacctagtgacccaagcaaattt
accttagctgtttccccagtagacccacctggcactcctgactacattgatgtcacccgg
gaaaccatcacactgaaatggaacccaccattgcgtgatggaggcagtaagatcgtggcc
tacagcattgagaaacgacaagggagcgatcgctgggttagatgcaactttactgatgtc
agtgaatgtcagtacacagtgacaggacttagtcctggggatcgatttgagttcagaata
attgcaagaaatgctgttggaactataagcccgccctcacagtcttctggcattattatg
acaagagatgaaaatgttccaccaatagtagagtttggccctgagtactttgatggtctt
actattaagtctggagagagccttagaattaaagctttggtgcaaggacgaccagtacct
cgagtaacttggttcagagatggagtagaaattgagaagaagatgaatatggaaataact
gatgtccttggatccaccagcctctttgttagagatgctacccgggaccatcgtggtgta
tatacagtggaagccaaaaatgtatctggcaccgcaaaagcagaaattaaagtcaaagta
caagatacaccaggaaaagtagttgggccaataagattcaccaacattactggcgagaag
atgaccctatggtgggatgctccactcaatgatggctgtgctcccataactcactacatc
attgaaaaacgggaaaccagcagacttgcttgggcactaattgaggataattgtgaaacc
ctcagttatactgccgttaaactaataactggcaatgaataccaattccgtatttctgca
gttaacaagtttggtgttggcaggccacttgattctgaccctgtggttgctcaaatacaa
tacactattcctgatgcccctggcactccagaacctaccaatgttacaggcaatagcatt
actctgacgtgggcaaggccagaatcagatggtggcaatgaaattcaacaatatatcctt
gaaaggagagaaaagaaaagcacacgatgggtaaaagtgatcagcaaacgaccaatctct
gagacaagattcaaagtcactggtctgacagagggcaatgagtatgaattccacgtcatg
gctgaaaatgatgcaggagtaggacctccaagtgggatctcaagactaatcaaatgtaga
gagccagtcaacccaccaagtgctcccactgtggtcaaagtgacagatacatcaaagaca
actgtgagcttagaatggtctaagccagtgtttgatggaggcatggaaataattgggtat
attattgaaatgtgcaaagctgacttaggagactggcacaaggtgaatgcagaggcatgt
gtgaaaacaagatacacagtcactgatctacaagccggtgaagaatacaaattccgggtg
agtgctatcaatggtgctggaaaaggagacagctgtgaagtgaccggcacaattaaagca
gttgaccgattaacagctcctgagttagatatcgatgcaaacttcaagcagactcacgtt
gttagagctggggccagtattcgcctcttcattgcctaccagggtagaccgactcctaca
gctgtgtggaccaaacctgactctaacctaagcattcgggccgatatccatacaacagag
tccttcagcaccctcactgtggaaaactgcaacagaaatgacgcagggaaatataccctc
accgtggaaaacaacagtggtagtaagtcagtcacattcaccgtaaaggtgctagactct
ccaggcccacctggccccattactttcaaggacgtgaccaggggatctgttacattgatg
tgggatgcccctctccttgatggtggcgcccgcatccatcactacgtggtagagaaacga
gaagcaagtcgtcgtagctggcaggttgtcagtgaaaaatgcattcgtcagatcctcaag
gtcaacgacctggtagaaggtgttccgtactatttccgtgtttctgcagaaaacgagtat
ggtgttggtgaaccctatgaaatgccagaaccaatggtagccacagaacagcctgctcca
cctaagagacttgatgttgttgacacaagcaaatcctccgcagtcttagcttggcttaaa
cctgaccacgatggaggcagccggattactggctacctgctcgaaatgagacaaaaggga
tctgacttctgggttgaagcaggtcacaccaaacagctgactttcacagtggagcgcctt
gttgagaacactgaatatgaattccgtgtgaaggccaagaatgatgctggctacagcgaa
cccagggaagccttctcttctgtcatcatcaaggagcctcaaattgagcccactgctgat
ctcactggaattaccaatcagctcataacttgcaaagcaggaagcacatttaccattgac
gtgccaatcagtggtcgtcctgcccccaaagtaacatggaagctcgaggaaatgagacta
aaggagacagatcgagtgagcatcacaacaacaaaagacagaaccactctgtctgtcaag
gacagcatgagaggtgactctggaagatacttcttgactctggaaaacacagctggagtt
aaaacatttaccatcacagttgtggtcattggaaggccaggtccagtaactggccccatt
gaggtctcatctgtctcagccgaatcatgtgtcctgtcatgggctgaacctaaagatgat
ggaggcaccgatattactaattatatagttgaaaagcgtgagtcgggtacaacagcttgg
cagcttgtcaattccagtgtcaagcgcactcagattaaagtcactcatctcacaaaatac
atggaatattctttccgtgtcagttcagagaacagatttggtgtcagcaagcctctagaa
tcagcaccaataattgctgaacatccatttgtcccaccaagcgctcctaccagacccgaa
gtctactatgtgtctgccaatgccatgtctattcgttgggaagaaccctaccatgatggt
ggcagtaaagtcattggctactgggttgagaagaaagaacgtaataccattctttgggtg
aaagaaaacaaagtgccatgcttagagtgcaactacaaagtgaccggtctggtagaagga
ctggagtatcagttcagaacatatgcgctcaatgctgcaggggttagcaaagccagtgaa
gcttcacgacctatgatggctcaaaacccagttgatgcaccaggaagaccagaggtgact
gatgtcacaagatcaacagtgtcactgatttggtcttccccagtgtatgatggaggcagc
aagattgttggctacatcatagagcgtaagccagtcagtgaagttggagacggtcgctgg
ctgaagtgcaactataccattgtatctgacaatttcttcactgtgactgctctcagtgaa
ggagacacttacgaattccgtgtgttggccaagaatgcagcaggggtaattagcaaggga
tcagaatctacaggccccgtcacttgccgagatgaatacgctcctcccaaagctgaactg
gatgccagattacagggtgatctggttaccatcagagcaggctcggatcttgttcttgat
gctgcagttggtggcaaacctgaacccaaaattatctggaccaaaggggacaaggaacta
gatctctgtgaaaaaatctctttgcagtatactggcaaacgagcaactgctgtgatcaaa
ttctgtgacagaagtgacagtggaaaatacactttaacagtgaagaatgccagtgggacc
aaggccgtgtctgtcctggtcaaagttcttgattcccctggcccatgtggaaagctcacc
gtcagcagagtaacagaggagaagtgcactttagcctggagccttcctcaggaagatgga
ggagcagaaataacacactacatcgtggaaagacgtgagactagcaggctcaactgggtg
attgttgaaggcgaatgcccaaccctatcctatgtagttaccagactcatcaagaacaat
gaatacatattccgagtgcgagcagtaaacaaatatggccctggtgtgcctgttgagtca
gagccgattgtagccagaaactcattcactattccatcacaacctggcatgcctgaagaa
gttggagctggcaaagagcatatcatcattcagtgggtaaaacctgaatctgatggtggc
aatgatatcagcaactacctagtagacaaacgtgagaagaagagcttgcgctggacacgt
gtcaacaaagactatgtggtgtatgataccaggctgaaggtgactggcctgatggaaggt
tgtgactaccagttccgggtgactgcagtgaatgctgctggtaacagtgaacccagcgaa
gcttccaactttatctcatgcagagaaccatcatatactcctggaccaccttctgctcca
agggttgtggataccaccaagcacagcattagtttggcatggaccaagcccatgtatgat
ggtggtgttgacatcacaggatatgttcttgaaatgcaagagaagggcactgatcagtgg
taccgagtgcataccaacgccacaataagaaatactgaattcactgtgctagaccttaaa
atgggccagaaatattccttcagagttgctgctgtgaacgtgaagggtatgagtgaatat
agtgagtcaaccgccgaaattgagcccgtggaaagactagaaataccagatcttgagctt
gcagatgatctaaagaagactgtgacactcagagctggggcctcattgcgcctgatggtg
tctgtatctggaagaccacctcctgtcatcacatggagcaagaaaggcattgaccttgca
agtcgggcaattattgacaccactgagagctactctttacttattgtggacaaagttaac
cggtacgatgctggaaaatacaccattgaagccgaaaatcaatctggcaagaaatcagca
acagttcttgttaaagtatatgatactcctggtccttgtccttcagtgaaagttaaggaa
gtatccagagattctgtgaccattacttgggaaattcccacaattgatggtggagctcct
gtcaacaattacattattgagaagcgtgaagctgccatgagagcattcaaaacagtaact
accaaatgcagcaagacactttaccgaatttctggacttgtagaaggatgcatgtactat
ttcagagtgttgccagaaaatatctatggcattggagaaccttgtgaaacatctgatgca
gttctagtctccgaagtgcctttggtgcctacaaagctagaagtggtggatgtcaccaaa
tcaactgtgagtcttgcctgggaaaaaccactctatgatggtggtagccgactcactgga
tatgttctcgaggcctgcaaagctggcactgagagatggatgaaggttgccaccttaaaa
cccacagtcctagagcacacagttatttccttaaatgaaggtgaacagtacttatttaga
gtaagggcacaaaatgagaaaggcgtgtcagaaccaagagagatcgtcacagccgttact
gtacaagatctcagagtgttgccaaccatcgatctttccacaatgcctcaaaagaccatc
catgtcccagcgggcagaccagtagagctggtgataccaatcgctggtcgcccacctcct
gctgcttcctggttctttgctggttctaaactaagagaatcagaccgtgtcacagttgaa
actcatactaaagtagctaaattaaccatccgtgaaaccactatcagagatactggagaa
tacacacttgaattgaagaatgtaactggaactacttcagagaccattaaagttatcatt
cttgacaagcctggtccaccaactgggcctatcaagattgatgaaattgaagctacttca
gttaccatttcctgggaaccacctgaattggatggtggtgctccactgagtggctatgtg
gtagaacaacgtgatgcccatcgtccaggatggctgccagtgtctgaatcagtgactaga
cagacatttaagtttaccagactcactgaaggaaatgagtatgtgttccgtgtggctgca
accaaccgcttcgggattggatcttacttgcaatctgaggtcatagaatgtcgcagcagc
atcagtattcctggacctccggaaacattacagatatttgatgtctcccgtgatggcatg
acactcacttggtatccaccagaggatgatggtggctcccaggtgactggatatattgtg
gagcgcaaagaagtgagagcagatcgatgggtccgcgtaaataaagtaccagtaaccatg
acacggtaccgttccactggccttattgaaggcttagaatatgaacaccgtgtcacagcc
attaatgcaagagggactggaaaaccaagtcgtccttccaaacccatcgttgccatggat
ccaattgctcctccaggaaagcctcaaaacccaagagttactgatacaacaaggacatca
gtctccctggcctggagtgttccagaagatgaaggaggatctaaagtcacaggctacttg
attgaaatgcaaaaagtagatcaacatgaatggaccaaatgtaacaccaccccaaccaag
attcgggagtatactctaacacacctacctcagggcgctgagtacagattccgtgtccta
gcttgtaatgctggcggacctggggagcccgccgaggtaccaggaacagtcaaagtcacc
gaaatgcttgaatatcctgattatgaactagatgaaagataccaggaaggtatctttgta
agacaaggtggagtcatcagacttaccataccaattaaaggaaaaccattcccaatatgc
aaatggaccaaggaaggccaagatattagtaagcgtgccatgattgcgacatctgaaacg
cacactgagcttgtgatcaaagaagcagacagagatgattctggcacttacgacctggtt
ctggaaaacaaatgtggcaaaaaggctgtttatatcaaggtcagggtgataggaaacccc
aacactccagaagggccacttgaatacgacgacatacaagctcgctctgtaagggtcagc
tggagaccacctgctgatgatggtggtgctgacatcttgggatacatcctcgagagacga
gaagtgcctaaatctgcctggtataccattgattccagagtccgaggtacatctctggtg
gtaaaaggcctcaaagaaaacgtagagtaccatttccgtgtttcagctgaaaaccagttt
ggaattagcaaacccttgaaatctgaggaaccagtcataccaaaaacaccactgaaccct
ccggagcctccaagcaatcctccagaagtactggatgtgaccaagagctctgtcagcctg
tcctggtcacggcccaaagacgatggtggttctcgagttacaggctactacattgaacgc
agggagacatcaactgacaagtgggtcagacacaacaagactcagataaccaccacaatg
tacaccgtcaccgggcttgttcctgatgctgaatatcagttccgcatcattgcacagaat
gatgttggcctaagcgagaccagccccgcttctgaaccagttgtttgcaaagatccattt
gataagccaagccaacctggagaacttgagattctttcaatatccaaagatagcgtcact
ctacagtgggagaaacctgaatgtgacggtggcaaagaaatccttggatactgggttgaa
tatagacagtctggagacagtgcctggaagaagagcaataaggaccgcatcaaggatagg
caattcacgatagggggtttgctggaagctactgaatatgaattcagggtttttgctgag
aatgagactggacttagcagacctcgaagaaccgctatgtctgtaaagactaaactaact
tctggagaggccccgggagtacgcaaagaattgaaggatgttaccaccaaattgggtgaa
gctgctcaactctcatgccagattgttgggaggcctctacctgacattaaatggtaccga
ttcggtaaggagctcatacaaagccggaagtacaaaatgtcttcagatggacgcacacat
acgctgacagtaatgacagaggaacaagaagacgaaggtgtctatacctgcatggctacc
aatgaggttggagaagtagaaaccagtagtaagcttcttttgcaagcaacaccacagttc
catcctggttacccactgaaagagaaatactacggtgctgtgggttcaacacttcgactt
catgttatgtacattggtcgtccagtacctgccatcacttggttccatggccagaaactt
ttgcaaaactcagaaaacattactattgaaaacacggagcactatactcatctcgtcatg
aagaatgtccaacgtaaaactcatgctgggaaatacaaagttcagctcagcaatattttc
ggaacagtcgatgctatccttgatgtggaaatacaagataaaccagacaaacctacagga
ccaattgtgattgaagctctattgaagaactctgtggtgatcagctggaaaccacctgca
gatgatggaggctcctggatcaccaattatgtagtggagaaatgtgaggccaaggaaggg
gctgaatggcaattggtgtcttcggccatctcagtgacaacctgtagaattgtgaacctc
acagaaaatgctggctattacttccgggtttcagctcagaacaccttcggcatcagcgac
cctctggaggtcccctcggttgtgatcattaagagtccatttgaaaagccaagtgctccc
agcaaaccaacgattactgctgtcacaaaagattcttgtgttgtggcttggaagccacct
gccagtgatggaggtgcaaagattagaaattactaccttgagaagcgtgagaagaagcag
aataaatggattgctgtgacaacagatgaaattcgagaaaccgtcttttcagtgcaaaac
cttattgaaggtcttgaatatgagttccgtgtgaaatgtgaaaacctaggtggggaaagc
gaatggagtgaaatatcagaacctgtcactcccaaatctgatgtcccaattcaggcacca
cactttaaagaggaactcagaaatctacatgtcagatatcagagcaatgctactttggtc
tgcaaagttactggtcacccgaaacctattgtgaaatggtacagacaaggcaaagaaatc
attgcagatggattaaagtacaggattcaggagtttaagggtggctaccaccagctcatc
attgcagctgtcacggatgatgatgccacagtttaccaagtcagagctaccaaccaaggg
ggatctgtgtcgggcactgcctccttggaagtggaagttccagctaagatacatttgcct
aaaactcttgaaggcatgggagcagttcacgctctccgaggtgaggtggtcagcatcaag
atccctttcagtggcaaaccagatcctgtgatcacctggcagaaaggacaagatctcatt
gacaataatggccactaccaagttattgtcacaagatctttcacatcacttgttttcccc
aatggagtggagagaaaagatgctggtttctatgtggtctgtgctaaaaacagatttgga
attgatcagaagacagttgaactggatgtggctgatgttcctgacccacccagaggagtc
aaagttagtgacgtctcacgagattctgtcaacttaacatggactgagccagcttctgat
ggcggcagcaaaatcaccaactacattgttgaaaagtgtgcaactactgcagaaagatgg
atccgtgtaggacaggcccgagaaacccgttataccgtgatcaacttatttggaaaaaca
agttaccagttccgtgtcatagctgaaaataaattcggcctgagcaagccttctgagcct
tcagaacctactataaccaaagaagataagaccagagctatgaactatgatgaagaggta
gatgaaaccagagaagtttccatgactaaagcatctcactcttcaaccaaggagctctat
gagaaatatatgattgccgaagatctcgggcgtggtcagtttggaatcgtccaccgttgt
gttgaaacttcctcaaagaagacatatatggccaaatttgttaaagtcaaagggactgat
caggttttggtaaagaaggaaatctccatcctaaacatcgctaggcacagaaacatctta
tacctccatgaatcatttgaaagcatggaagaattagtcatgatctttgagttcatatca
ggacttgacatatttgaacgcattaacacaagtgcttttgaacttaatgaaagagaaatt
gtaagttatgtccgccaggtctgcgaagcacttgagttcttacatagtcataatattgga
cactttgacattaggccagacaatatcatttaccaaacaagaaggagctccgtcattaaa
atcatagaatttggtcaagcccgtcagctgaagccaggggacaactttaggcttctgttc
actgcccctgaatattatgcccctgaagtccaccaccatgatcttgtcagcacagccaca
gacatgtggtcacttggaacactggtctatgtgctgttgagtggtaccaatccattcctg
gctgaaactaaccaacagataattgagaacatcatgaatgctgaatttacttttgatgaa
gaagcattcagagagattagccttgaagccatggattttgttgaccggctgttggtgaaa
gagagaaaatctcgcatgacagcatctgaggcactccagcacccatggctgaagcagaag
acagaaaaagtcagtactaaagttatcagaacattaaaacaccggcgttactatcacacc
ctgatcaagaaagatctcaacatggttgtatcagcagcccggatctcctgtggtggtgca
attcgatctcagaagggagtgagtgttgctaaagttaaagtagcatccattgaaattggc
ccagtttctgggcagataatgcatgcagttggcgaagaaggaggatatgtcaaatatgta
tgcaaaattgaaaattatgatcagtctacccaagtgacctggtactttggtgtcagacag
ctggagaacagtgagaaatatgaaatcacctatgaagatggcgtggccaccatgtacgtc
aaacatattaccaaattcgatgacggcacctacagatgcaaagtagtcaatgactatggc
gaagacagttcttatgcagagctatttgttaaaggtgtgagagaagtttatgactattac
tgccgtagaactatgaagaaaattaagcgcagaactgatacgatgagactcctagaaagg
ccaccagaatttaccctgcctctctataacaagacagcttatgtgggtgaaaatgtccgg
tttggagtaaccataaccgtccacccagagcctcgtgtaacatggtataagtcaggtcag
aaaatcaaaccagatgatgatgacaagaagtacacctttgaatctgacaagggtctttac
caattaacaatcagcagtgtaactctagaagacgatgctgagtatactgttgtcgcaagg
aacaaatatggtgaagacagctgtaaagcaaagctgactgtaaccccacacccacctcca
acagatacaaccttaagacccatgttcaaacggctactggcaaacgcagaatgccaagaa
ggccaaagtgtctgcttcgagatcagagtgtctggcatccctgcaccaacgctaaaatgg
gagaaagacggtcagccgctgtcccttgggcccaacattgaaattatccacgaaggcttg
gactattatgctttgcacatcagggatactttgcctgaagacacaggttattatagggtc
acagccacaaacacagcaggatctaccagctgccaggctcacctacaagtggaacgcctg
aggtacgtcaaacatgaatacaagagcaaggaggagcgcgaacgacatgtacaaaggcaa
attgacaagacactaagaatggctgaaattctttctggaactgaaagtgtgccactgaca
caggtagcccaagaggctctgagagaagctgccatcctttacaaaccagctataagcacc
aagactgtaaaaggggaattccgacttgagacggaagaaaagaaggaggagagaaaactc
cgtatgccttatgaggtaccagagccacgcaagtacaagcagactaccatagaagaagac
caacacattaagcagtttgtgcctatgtctgacatgaaatggtacaaaaagatacgcgat
caatttgaaatgcctgggaaacttgacagagttgtacagaaaagacccaagcgcatccgc
ctttcaagatgggaacagttctacgtgatgcctcttccacgctttacagatcaatacaga
cccagatggcgtattcccaaactgtctcaagatgatcttgaaatggtgagaccagcacgc
cggcgtacaccttctcctgattattacttttattacagaccgagaagacgttctcttggt
gacatctcagatgaagaattactcttgcccattgatgactacttggcaatgaaaagaaca
gaagaagagaggttgcgtcttgaggaagagcttgaattaggtttctcagcttcaccccca
agccgaagccctccacgttttgagctatccagtctgcgttactcttcaccacaagctcat
gtcaggacggaggaaacaagaaaagacttcagatattcaacctatcacatcccagtgaag
gctgagactagtacaagttatgcggaactgcatgaacggcatgcccgggcctcctataga
cagccgaaacaacggcaaaggatcatggctgagaaggaggatgaagagttgcttcgtcca
gttactaccacccagcgtctctcagcatacaaaagcgagcttgaccacatatcaaaggaa
gaaaagtctagaaagaaatcaagacaacagagagaagtgacagaaataacagaaattgag
gaagaatacgaaatctcaaaacatgctcaaagagagacatcctcatctgtgtctagactg
ctgagacgacggcgctccctgtctccaacttacattgagttaatgaggccagtgtccgag
ctgatccggcgacgtccacagccggctgaggaatatgaagacgaatatgaagatgacaca
gaaagaaggtctcctactccagagagaactcgcccccgctcccccagccccgtgtccagt
gagaggtctctctcaagatttgagcggtctgcaagatttgatatcttttccaggtatgag
tccatgaaagctgctttaaagactcagaagacctcagaaaggaagtatgaagttttgact
cagcagccttttacgctggaccatgcccctcgaatcacattgagaatgcgctcccacagg
gtaccatgtggccaaaatacatgttttatcttaaacgttcagtctaagccaactgccgag
gttaaatggtaccataatggtgtagaactccaagagagcagtaagattcgttacaccaac
atgagtggggtactgaccctggaaattctggactgtcatattgatgacagtggaacatac
cgtgctgtgtgcaccaactacaaaggggaagcttctgactatgcgaccttggacgtaacg
ggaggggattacaccacctatgcttcccagcgcagagacgaagatgtcccccgatctgtt
ttccctgagctgacaagaatagaggcatatgcggtgtcttcatttaagaaaacatctgag
atggaagcttcttcttcagtcagggaaatgaaatcacagatgacagagacaagggaaagt
ctctcatcatatgaacaccatgcatctgcagaaatgaaaagcgctgcaatagaagaaaag
tcgctggaagaaaaatccacacacagaaagatcaagacaactttggcagcaagaattcta
accaagccaaggtccataactgtctatgaaggcgagtccgcaaggttttcttgtgataca
gatggtgagccagtaccaactgtgacctggctgcgtggaggacaagtgatcagtacttcc
gcccgccaccaagtgaccaccacaaagtacaaatcgacctttgagatctcttcagtccag
gcttccgacgagggcaactacagcgtggtggtggagaacagtgatgggaagcaagcagca
cagtttaccctgactattcaaaaggcccgggtgaccgaaaaggctgtgacagcaccacca
agagtcaaatccccagagcctcgggtgaaatctccagaaggagttaagtctccaaaacga
gtgaaatccccagaaccagtgacttctcacccaaaagctgtctcaccaacagagacaaaa
cccacagcaacagagaaactccagcagctccctgtctctgccccacccaggataactcag
tccctgaaagcagaagcttctaaagatattgcaaagctgacctgtgcagtcgaaagtagt
atattatctgcaaaagaggtcacctggtataaagatggcaagaaactgagggaaaatgga
catttccagtttcattattcggcagatggtacctatgagctcaaaatccataacctcact
gaatccgattgtggagaatacgtttgtgagatttctggtgaaggtggaagttccaaaact
aacttccagtttacgggacaagcctttaagagtatccatgagcaggtatcaagcatagca
gaaactaagaaatcagctcagaaaactgctgagtcaacagaaaccaagaaatcagttcag
aaaactgctgagtcgacagaaaccaagaaaacagctcagaaaaccactgagtcgacagaa
accaagaaaacagctcagaaaactgctgagtcaacagaaaccaagaaaactgagccaaaa
gctccggaaccaatttcctcgaaaccagtaattgttactgggctacaggatacaaccgtt
tcttcagatagcactgctaaatttgtagttaaggttaccggagaaccccggccaactgtc
atctggacaaaagatggaaaggctattacacaaggaggtaaatataaactctctgaagac
aaaggaggattcctcctagaaattcataagactgagacctctgacggcgggctttatact
tgcacaataacaaattcagccggctctgtgtcctcgagctgcaaattaacaataaaagct
gtaaaagacactgaggcgcagaaagtatccacacaaaagacctctgaaattacatcccag
gagaaggcagtagtccaggaagaaatttcccaaaaagccctaatttctcaagaaatcaag
aagtcagaggtgaaatctcaggaaaagttagccatgaaggaggaagcttcaaaggttctg
atttctgaaaaagtcaagaaatcagaagcagcttccctggataaatccattgtccatgag
gaaatctctaaaacatcacaggcatccgaagaaatcagaactcaggccgaggtgaaggca
ttctctactcagatgagcataaatgatggtcagaaagtgactttaaaagccaacattgct
ggagccactgatgtgaaatgggtactgaatggagtagagctaactaactccgaggagtac
agatacggtgtctcaggcagcgatcagaccctaaccatcaagcaggccggtcacaaagat
gcaggaatcctcacctgcatcggcaaaaccagccaaggaatcgtcaagtgtcagtatgat
ctgaccctgagcaaagaactctcagatgctccagccttcatctcacagcccagatctcaa
aacgttaacgaaggacaaaatgttctcttttcttgtgaaatcagtggcgagccatcccca
gaaatcgaatggtttaaaaacaacctcccgatttccatttcttcaaatatcagcgtaagt
cgctctagaaatgtatattctcttgaaatccgaaatgcatctgaaagcgacagtgggaag
tacacagttaaggccaaaaatttccgtggccagtgctcagctactgcttctctcacggtc
cttcctctagttgaagaaccttccagagaggtagtattgaggacaagtggtgacacgagc
ttgcacggaagcttctcgtctcagtcaatgcaaatgtcggcctctaagcaggaggcctcc
ttcagcagtttcagcagcagcagtgctagcagcatgactgaaatgaaatttgcaagcatg
tctgcccaaagcatgtcctccatgcaggagtcctttgtagaaatgagttccagcagtttt
atgggaaaagctagcatgacacaactggaaagctcaactagtagaatgcttaaagcaggc
ataagaggagttccacctaaaattgaagctcttccctctgacatcagcattgatgagggc
aaagttttaacagtagcctgtgcttttacgggtgagcctactccggaaataacgtggtcc
tgtcgtggaagaaaaattaaaaatcaagaacaacaagggagattccttattgaaaacaca
gatgacctgacaactctgatcatcatggacgtacagaaacaagatggtggaatttatacc
ctgagcttagggaatgaattcggatctgactctgccactgtgaatataaatattcgatcc
atttaa

DBGET integrated database retrieval system