KEGG   Escherichia coli K-12 W3110: JW4057
Entry
JW4057            CDS       T00068                                 

Gene name
phnL
Definition
(GenBank) carbon-phosphorus lyase complex subunit
  KO
K05780  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnL [EC:2.7.8.37]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00440  Phosphonate and phosphinate metabolism
ecj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    JW4057 (phnL)
Enzymes [BR:ecj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     JW4057 (phnL)
SSDB
Motif
Pfam: ABC_tran AAA_16 SMC_N AAA_21 AAA_22 AAA_33 AAA_29 RsgA_GTPase NACHT AAA_30 AAA_25 TsaE SbcCD_C Viral_helicase1 VirE FtsK_SpoIIIE DUF815 Septin AAA_23 AAA_14 AAA_7 RNA_helicase MMR_HSR1 NB-ARC cobW SIS_2 Gtr1_RagA
Other DBs
NCBI-ProteinID: BAE78099
UniProt: P16679
Position
complement(4321893..4322573)
AA seq 226 aa
MINVQNVSKTFILHQQNGVRLPVLNRASLTVNAGECVVLHGHSGSGKSTLLRSLYANYLP
DEGQIQIKHGDEWVDLVTAPARKVVEIRKTTVGWVSQFLRVIPRISALEVVMQPLLDTGV
PREACAAKAARLLTRLNVPERLWHLAPSTFSGGEQQRVNIARGFIVDYPILLLDEPTASL
DAKNSAAVVELIREAKTRGAAIVGIFHDEAVRNDVADRLHPMGASS
NT seq 681 nt   +upstreamnt  +downstreamnt
atgattaacgtacaaaacgtcagtaaaaccttcatcctgcaccagcaaaacggcgtgcgc
ctgcccgtcctcaatcgcgcctcgctcaccgtcaacgcgggcgaatgcgtggtgctccac
ggccattccggcagcggcaaatcaactctgctacgctcgctgtacgccaactatctgccc
gacgaaggtcaaatccagatcaaacacggtgacgagtgggtagacctggtcaccgcgcca
gcgcgcaaagtggtggaaatccgcaaaaccaccgtcggctgggtgagccagtttctgcgc
gtcatcccgcgtatctcagcactggaagtggtgatgcagccgctgctcgataccggcgtt
ccgcgtgaagcctgcgccgctaaagccgcgcgtcttctcacccgcctgaacgtgccggaa
cgcctgtggcacctggcaccatcgacattttccggtggcgaacagcagcgcgtcaacatc
gcccgcggctttatcgtcgactaccccattctgctgcttgacgaacctaccgcctcgctg
gacgccaaaaacagcgccgcggtggtggaactgattcgcgaagccaaaacccgtggcgca
gccatcgtaggcatcttccatgacgaagctgtacgtaatgacgtcgccgaccgcctgcac
ccaatgggagcctcttcatga

DBGET integrated database retrieval system