KEGG   Ehrlichia canis: Ecaj_0533
Entry
Ecaj_0533         CDS       T00270                                 
Name
(GenBank) CagE, TrbE, VirB family component of typeIV transporter system
  KO
K03199  type IV secretion system protein VirB4 [EC:7.4.2.8]
Organism
ecn  Ehrlichia canis
Pathway
ecn03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ecn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Ecaj_0533
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecn02044]
    Ecaj_0533
Enzymes [BR:ecn01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Ecaj_0533
Secretion system [BR:ecn02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Ecaj_0533
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_10 AAA_22 ABC_tran DUF87 FtsK_SpoIIIE AAA_23 nSTAND3 AAA_7
Other DBs
NCBI-ProteinID: AAZ68569
Position
complement(778764..781166)
AA seq 800 aa
MLKFQQLQTKRRKVINREYHESNFIPYSEHWNSSTLMTKDGSMLKVIKLSGYAFETADDE
DLSIQNSIRNQMLRSISSASFGLYFHIIRRRRNAFSEGFASDKVASSFANYVNVKWREKH
ETKQSFTNDLYITIVRESGKQGVEFLSSIFGKFGKVASQESWIKDLQAIYEDLDEVTNRV
FTSLRNYMPRVLGIRETPKGVFSEIMEFLLQIVNCGSFQRVLFSIGDVSKYLPMHRLYFG
HKTIQIVAHNECKYAGLISLKEYGQSTSAGMLDAFLQLPYEFIITQSFSFTNRQSAITKM
QIQQNRMIQSADKAVSQVVEISQALDDAMSGRIAFGQHHLTILCTERSLKTLDNALSLIE
SELSNCGVYPVRERINLEPAFWAQLPGNFEYIVRKAIISTLNMAGFASQHNYPIGKKFNN
HWGEAVTVFDTTSGTPFFFNFHIRDVGHTAIIGPTGGGKTVLMNFLCAQAMKFSPRIFFF
DKDYGAEIFIRALSGVYMIVEPRNPTGFNPLQLDDTPDNRTFLMEWMKSLISVFNDKFTS
EDITRINDAIEGNFKLKKEHRVLCNLVPFLGLDGPNTLAGSISMWHSKGSHAAIFDNAED
LLDFNKSRVFGFEMGHLLKDPVSLAPVLLYLFHRISISLDGTPSIIVLDEAWALIDNPVF
APKIKDWLKVLRKLNTFVIFATQSVEDASKSAISDTLVQQTATQIFLPNLKATSAYRNVF
MLTEREYTLIKHTDPSTRFFLVKQGVSAVVARINLSGLEDVISVLSGRAETVLMLRDLIK
EVGDDPNTWLPIFYERVKHV
NT seq 2403 nt   +upstreamnt  +downstreamnt
atgttaaaatttcagcagctgcaaacaaaaagaaggaaagtgatcaatagggagtatcat
gagtccaattttattccctatagtgaacattggaattcttctacattaatgaccaaagat
gggtcaatgcttaaggttattaagttatctggttatgcttttgaaactgctgatgatgag
gacttatctatacagaattctattcgtaatcaaatgttaagaagtatatcttctgcgtct
tttggtttgtattttcatataattagacgtaggagaaatgctttttcagagggatttgct
agtgataaagtagctagttcatttgcaaattatgtaaatgtgaaatggcgagaaaagcat
gagacaaaacaatctttcactaatgatttgtatattacgatagttagagaaagtggaaaa
cagggggtagagtttttatctagtatttttggtaaatttggaaaggttgcatcacaagag
tcatggataaaggatttgcaagccatatatgaagatttagatgaagtaacaaatcgtgtt
tttacaagtttgcgtaactacatgcctagagttttaggaattagggaaacgccgaaaggt
gtattttctgaaattatggaatttttattacagatagtaaattgtggatcttttcaacgt
gtattattttctataggtgatgtgtcaaagtatttaccaatgcataggttatattttgga
cataaaacaatacagatagttgcacataatgagtgtaaatatgctggattaattagtcta
aaagaatatggccaaagtacatctgctggtatgctagatgcttttttgcaattgccttat
gagtttattattacgcaatcttttagttttactaataggcagagtgcaattactaaaatg
cagattcaacagaaccgtatgatacaatctgcagataaggcagtatcacaagtagtagaa
ataagtcaagctttagatgatgcgatgagtggtagaattgcttttggacaacatcatctt
actattttatgtacagaaaggagtttaaagactcttgataatgcattgtctttaatagaa
tctgaattatctaactgtggtgtatatccggttagagaaagaattaatctagagccagca
ttttgggctcaattgccaggtaattttgagtatatagttcgtaaggctataataagtacg
ttaaatatggctggttttgcatctcagcataattatccaattggcaagaagtttaataat
cattggggtgaagcagtaacagtgtttgatactacttctggaactcctttcttttttaat
tttcatattcgcgatgttggtcatactgcaattatagggcctactggtggtggaaaaaca
gtgttaatgaatttcttgtgtgctcaagccatgaaattttcaccgaggattttctttttc
gataaagattatggtgctgaaattttcattagagcattgagtggcgtttatatgattgta
gaaccaaggaatcctacaggatttaatcctttacagcttgatgatactccagataatcgt
acattcttaatggaatggatgaagtctttaatatcagtattcaatgacaaatttacttct
gaagatataactcgtattaatgatgctatagaaggtaattttaagttaaaaaaggagcat
agggtattatgtaatttagtcccgtttttaggattagatggtccaaatactttggctggt
tcaatatctatgtggcatagtaaaggatctcatgcagccatatttgataatgcagaagac
ttattagattttaataaatctagggttttcggttttgaaatgggtcatttgcttaaagat
ccagtatctcttgctcctgtgttgttatatttatttcatagaattagtatttctttggat
ggtactccgtctattattgtattagatgaggcatgggcattaatagataatccagtattt
gctccaaagataaaagattggttgaaagttttaagaaaattaaatacatttgtgattttt
gctactcaaagtgttgaagatgctagtaaaagtgcaattagtgatactttagtgcaacaa
actgctactcaaatatttttgcctaatttaaaagctactagtgcttatagaaatgtattt
atgttaacagagagggaatatactttaataaaacatacggatcctagtacaaggttcttt
ttagtaaaacagggggtaagtgcagtagttgctagaattaatttaagtggccttgaagat
gtaataagtgttttgtctggtagagcagaaacagtcttaatgttacgtgatttaataaag
gaagtaggagatgatccaaatacttggttgcctatattctatgaacgagtaaagcatgtg
taa

DBGET integrated database retrieval system