KEGG   Escherichia coli APEC O1 (APEC): APECO1_O1R153
Entry
APECO1_O1R153     CDS       T00425                                 
Symbol
traG
Name
(GenBank) TraG
  KO
K12071  conjugal transfer pilus assembly protein TraD
Organism
ecv  Escherichia coli APEC O1 (APEC)
Brite
KEGG Orthology (KO) [BR:ecv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecv02044]
    APECO1_O1R153 (traG)
Secretion system [BR:ecv02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   APECO1_O1R153 (traG)
SSDB
Motif
Pfam: TrwB_AAD_bind TraG-D_C AAA_10 ATPase HerA_C FtsK_SpoIIIE AAA_22 DUF87
Other DBs
NCBI-ProteinID: ABF67838
UniProt: A0A0H2XKR0
Position
pAPEC-O1-R:175754..177838
AA seq 694 aa
MSDSKRTNLHAQENFYRPILEYRSASILLICSVSMLYMGLSSDGLDIAPIVLFTSILLFL
LCLYRCKTAAPFLMAHWRVFKRHFMFVSLDSLRVINKSNFFSNERKYRQLVQDYQNKNKD
IPERKSYFCDGFEWGPEHADRAYQIANLSSDKREIELPFVFNPIKRHFDAMARKMGGSNA
IFAVERREPIFVTEDNWFGHTLITGNVGTGKTVLQRLLSISMLHLGHVVVVIDPKNDAEW
RESLMEEAKTLGLPFYKFHPGQPASSVCIDVCNTYTNVSDLTSRLLSLVTVPGEVNPFVQ
YAKALVSNVISGLSYIEKKPSIYLIHKNMKSHMSIVNLTVKVMESCYARYYGYDVWTEKV
KYVANETLPVRFKRLAEWFTAHFMNYEGSEQIDWLDTVSQLIDYSMSDPEHMAKMTAGIM
PVFDMLIEKPLNELLSPNPNSVSSREIVTSEGMFSTGGVLYISLDGLSNPDTAAAISQLI
MSDLTSCAGSRYNAQDGDMSANSRISIFVDEAHSAINNPMINLLAQGRAAKIALFICTQT
ISDFIAAASVETANRITGLCNNYISLRVNDTPTQTLVVENFGKSAISTNMVTYTTGSETS
LPHNNFSGSISERKQTTLEESIPKDLLGQVPMFHIVARLQDGRKVVGQIPIAVAEKQMKP
NTTLSEMLFKKAGKVTLRQNLDIKNLNKFLRKLH
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgtcagattcgaagaggactaacctccatgcacaagagaatttttatcggcctattctt
gagtatcgtagtgcctcaatacttttgatttgttcggtttctatgctttatatgggactt
tcttcagacggactggacatcgccccaatagttctgttcacctcaatattgctttttttg
ctgtgcctttatcgttgcaaaacagcagcgccattcttgatggctcattggcgtgtattc
aagcgacatttcatgttcgttagtcttgattcactgcgtgtaattaacaaaagtaacttt
ttctccaatgagcgaaagtatcgtcaactggttcaggattatcaaaataaaaataaggat
atacccgagcgaaagtcctatttttgtgatgggtttgagtggggcccggaacatgcggat
cgggcatatcaaatagctaacctctccagtgataaacgtgagatcgagttgccattcgtc
ttcaacccaattaagagacattttgacgcaatggctcgtaagatgggcggcagcaatgca
atttttgctgtggaacgtagggaacccatatttgtaactgaagacaattggtttggtcat
actctgataaccggaaacgtgggtaccgggaaaacggtgctacagcgtttactaagcatt
agcatgcttcatcttggtcatgttgttgttgtcatagatccaaagaacgatgcagagtgg
cgagaatctctaatggaagaggctaagaccctcggtcttcctttctataaatttcatcct
ggccagccagcatcttcggtctgtattgatgtctgcaacacctatactaatgtttctgac
ctaacatctcgtcttttgagcttggtgacagttcccggtgaggttaacccattcgttcag
tatgccaaggctctcgtttccaatgtgatttccgggctttcttacatagagaaaaagcct
tctatttatctgattcacaagaacatgaaaagccacatgtctattgtgaatcttacagtc
aaggtaatggagtcatgttacgcgagatattatggttacgatgtctggaccgaaaaagtt
aagtacgtcgctaacgaaaccttgccggtacgtttcaagcgtctcgctgaatggtttacg
gctcatttcatgaattacgaggggtccgaacaaatagactggttagatactgtttcccag
cttattgattactcaatgtccgacccagagcatatggctaaaatgaccgcaggtattatg
cctgttttcgatatgctcattgaaaaacctttaaatgagcttttatctcctaacccgaac
tcagtatcatcaagagaaattgtaacaagcgaagggatgttcagcactggcggggtgcta
tacatttcgcttgatggcctttcaaaccccgatacagcagctgctatttctcaattaata
atgtcagatctgacctcctgtgccggtagtcgctacaacgctcaggatggtgatatgtca
gctaattccaggataagtatttttgttgatgaggcacactcagccattaacaaccctatg
attaaccttctggcgcagggtcgtgcagcgaaaattgcactgtttatttgcacccaaacc
atctccgactttattgctgcggcaagtgttgaaactgccaatcgaattacggggctctgc
aacaattatataagcttgcgagtcaacgatactcctactcagacgcttgttgtagagaac
tttggtaagagtgcgataagcacaaatatggtcacttatacgaccggttcagaaacatct
ttgccgcataataacttctcaggttcaatctcagaaagaaagcagacaactttagaagag
agtattccaaaggatctcttgggtcaggtccctatgtttcacatagttgccaggcttcaa
gatggcaggaaggttgtaggccaaatccctattgctgttgctgagaaacaaatgaagcca
aacacaactctgtcggaaatgcttttcaagaaggccggaaaagttactttgcgtcaaaat
ctcgatatcaaaaatcttaataaatttctaaggaagttgcattga

DBGET integrated database retrieval system