KEGG   Escherichia coli APEC O1 (APEC): APECO1_O1R31
Entry
APECO1_O1R31      CDS       T00425                                 
Symbol
trhI
Name
(GenBank) TrhI
Organism
ecv  Escherichia coli APEC O1 (APEC)
SSDB
Motif
Pfam: UvrD_C UvrD-helicase AAA_19 UvrD_C_2 AAA_12 Viral_helicase1 AAA_30 PhoH ResIII DEAD
Other DBs
NCBI-ProteinID: ABF67714
UniProt: A0A0H2XK43
Position
pAPEC-O1-R:38510..40294
AA seq 594 aa
MGKPTEEQRPVIENASANNMVIAAPGSGKSFTMIEAVISILKKYPYARIGMVTFTRAATN
ALAAKLQKRLSKKDLDRVLVDTFHGLVKKQLDMIRWPGKMLIGPAQRSVIHRALKESGVT
MKFAEAEFVIDAIGREMDTDVISVRHNRQQIHLFNTYQALCQKDHVADLNALSKFVVGQM
HSGKMRTLDLTHLIVDEVQDTDSIQFSWIALHTRAGVYTSIVGDDDQAIYSFRSSGGVKI
FQQFEKHFRPNIFYLNTCFRCEPEILEVAGALIGKNVYRYAKELRSAKKGGGKVTFRSYV
DMEEQIQGILSLINQDPHGWAILSRNNAHLDELESLIEQPVIRYGGKSFWDEKETSDVLS
LMAFFRQSNDPRLMKRVLALFGEQESVLDEVALSMRGRKVTFGDLAIPEDSSLETKTLHS
NFVRFTQESTDKVEIAKRFANLTKWMESSSIKMRSNKGTATLTKIALDTCKQWAEKTGWM
NMINRAAAMSLGPRKKDEEYSPEKVVLSTLHGSKGLEWNKVIIMSCNADQIPSKRSVGEE
AIEEERRLLYVGFTRAEKQLFVMWYGDPSFFLRECSEEKIKEAANIRISPVYTE
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgggtaagccaacagaagagcaaagacctgttatcgagaatgctagcgcaaacaatatg
gtgatagcagcgcctggatcaggcaaatcattcaccatgatagaagcggttatatcgatt
ctcaaaaagtatccatatgcaagaatcgggatggtgacctttactcgcgctgcaacaaac
gcacttgcagcaaagttacaaaagcgattgagcaagaaggatcttgaccgggtgctggtg
gatacttttcacggactcgttaagaagcaactggacatgattcgctggccgggaaagatg
ttgatagggccagcacagagatctgtcattcaccgggctttgaaagaatccggtgtaacg
atgaagtttgctgaagctgaattcgttattgatgctatcggcagagaaatggatacggat
gtgatttcagttcggcataacagacaacagatccatttatttaatacctatcaggcgtta
tgccagaaagaccatgtggcggacctcaatgctctttcaaaatttgttgtcggtcaaatg
cattcgggaaaaatgcgcacgttagatttgacacatttgatagtagacgaagttcaggat
actgactctatacaattctcatggatagcattgcatacaagagctggagtctatacgagt
atagttggagacgatgatcaggccatctactccttcagatcctcaggaggagtcaaaata
tttcaacagtttgaaaaacacttcagacctaacatattttacttaaacacatgctttagg
tgtgaacctgaaattttagaggtggccggagcactgataggaaagaatgtttaccgttat
gccaaagagttacgctcggcaaaaaagggaggaggaaaggtcacttttcgttcatatgta
gatatggaggaacagatacagggtattttaagccttataaatcaggatccacatggatgg
gcaattctaagccgcaataatgctcacttggatgagctagaaagtttgatcgaacagcca
gtaattcgttacggaggtaaatcattctgggatgaaaaagaaacaagcgatgtgttaagc
cttatggcctttttccgacaatcaaatgatcctcgcttaatgaagagagtattggcattg
tttggagaacaggaatcagttttggatgaagtggcattgagtatgagaggaagaaaagtt
acttttggcgaccttgccatcccggaggacagttctctcgaaacaaaaacattacattca
aacttcgtgcgctttacccaggaaagtactgataaagttgagatagcaaaacgtttcgcc
aaccttacgaaatggatggaatcgtcgtcaatcaagatgaggagtaataaaggtacagca
accttaacaaaaattgctttagacacttgtaaacagtgggcagaaaagactggttggatg
aatatgatcaatcgtgctgctgcaatgtcattaggccctaggaagaaggacgaggaatac
agcccagagaaagtagtcctatcaaccttgcatggttcaaagggtcttgagtggaataaa
gtaataataatgagttgtaatgcggatcagataccaagtaaaagatcagttggggaggag
gcaatagaagaagaaagacgtttgctttatgttggatttacgcgtgcagaaaagcaactt
tttgtaatgtggtatggtgacccttctttctttttaagagaatgcagtgaagaaaagata
aaagaagcagctaatattcgaatttctccagtttatacagaataa

DBGET integrated database retrieval system