KEGG   Escherichia coli APEC O1 (APEC): APECO1_O1R7
Entry
APECO1_O1R7       CDS       T00425                                 
Symbol
trhB
Name
(GenBank) ThrB
  KO
K12065  conjugal transfer pilus assembly protein TraB
Organism
ecv  Escherichia coli APEC O1 (APEC)
Brite
KEGG Orthology (KO) [BR:ecv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecv02044]
    APECO1_O1R7 (trhB)
Secretion system [BR:ecv02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   APECO1_O1R7 (trhB)
SSDB
Motif
Pfam: TrbI MMR1 UPF0242 DUF6779 Ly49 FUT8_N_cat TAP35_44 Lectin_N Pilin_N DUF948
Other DBs
NCBI-ProteinID: ABF67690
UniProt: A0A0H2XJJ0
Position
pAPEC-O1-R:5258..6625
AA seq 455 aa
MELIMDIKKAWENKTVRLSVIGALLVVIVYIISQSIFSTPVKKEKKTQKKDMQTNLLLDD
SQMNKLSNEESQKVYKEMVKQNRLDQNAAKEDREKAEKAQQETKAQVASLTSQLQQLSQQ
INDMQTNRNGNRNLDAGSSRKTINEQAPAAPYQLNANAPINGVNPNYASITPTRNSPMRT
ITQSSIKTNGTDGVIQVMPVSENRIKEGREVIAGDKAPTRTVRGDGTAPVDSKARHAARK
DEMFLPATSIITGVLITGLEAPTSLSSKSEPMPVTMRIKKDVIMPNNFTMDLRDCNLLGS
AVGDLASQRAYIRATSISCVNSKGKAFDVKLEAYAVSENDGKNGIRGTLISRNGNAIAGA
AFAGGLSSLAGSLSPSKVSSLNIDPNSQAQYQSPNFGALGALAGAGAAQGGLNRLVDYYT
AIAEQQWPIVEISPGRAITFVVQTGTTIPTNLTSR
NT seq 1368 nt   +upstreamnt  +downstreamnt
gtggagctaatcatggacattaaaaaggcctgggaaaataagaccgtcagactttctgtt
attggcgctctgctggtagtgattgtttatattattagccagtctattttttccacacca
gttaagaaagaaaagaaaacacagaaaaaagacatgcagaccaatttgttgttagatgat
tcgcaaatgaacaaattgagtaatgaagaaagccagaaagtatataaggaaatggttaag
caaaaccgacttgatcaaaatgcggcgaaagaggaccgcgaaaaagcagaaaaagcccaa
caggaaactaaagcccaagttgcaagtttaacttctcaacttcagcagctgtctcagcaa
attaatgatatgcagactaatcgaaacggcaatcgtaacttggatgctggtagttcgcgt
aaaacgattaatgagcaggcaccggcagctccttatcagcttaatgctaatgcgccgatt
aatggcgtaaaccctaattacgcgtctatcacacctacgcgtaatagcccgatgagaaca
atcacacaaagttccattaagactaatggtaccgatggtgtcattcaggttatgcccgtg
tctgaaaacagaatcaaggaaggtagagaggtcattgcaggagataaagcgcctactcgg
actgtacgaggtgatggtactgcgccagttgatagcaaagcgcggcatgctgcccgaaaa
gatgaaatgtttcttccggcaacatctattatcactggtgttctgattaccgggcttgaa
gcgcctacaagcctttcttccaaatcagaaccaatgccagtaacaatgcgtattaaaaaa
gatgtcatcatgcccaataatttcaccatggatttgcgtgactgtaaccttctgggttca
gctgttggtgatttggcgtcacagcgtgcttacatacgtgccacttctatctcttgtgtt
aattcaaaagggaaagcttttgacgtaaaactggaagcatatgctgtaagtgaaaatgac
ggaaaaaatgggatccgaggcacgcttatcagccgaaatggtaacgcaattgcaggagct
gcatttgccggtggactttcttcacttgccggtagcttaagccccagtaaggtatcttca
cttaacatcgaccctaattcacaggctcagtatcagtcccctaattttggtgcacttggg
gcattagccggggctggtgcagctcaaggtggccttaatcgactcgtcgattactacacc
gcaattgcagaacaacagtggccaatcgtagaaattagccctggccgagctattacattt
gtcgttcagaccggaactacaattccaacgaatctgaccagtcgctga

DBGET integrated database retrieval system