KEGG   Enterococcus faecalis D32: EFD32_2221Help
Entry
EFD32_2221        CDS       T02172                                 

Definition
(GenBank) exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
efd  Enterococcus faecalis D32
Pathway
efd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:efd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EFD32_2221
Enzymes [BR:efd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     EFD32_2221
DNA repair and recombination proteins [BR:efd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     EFD32_2221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 AAA_11 Viral_helicase1 HHH_5 T2SSE AAA_22 HHH_8 AAA_12 AAA_28 AAA Cas_Csa4 DUF2075 RsgA_GTPase AAA_18 IMS_HHH CPT AAA_29 UvrD_C NTPase_1 HTH_IclR UvrD-helicase AAA_16 IMCp
Motif
Other DBs
NCBI-ProteinID: AFO45103
Position
complement(2302931..2305540)
Genome map
AA seq 869 aa AA seqDB search
MVTLFGEDEEKAFIVGTVQAIFFENPSNFYKVVLVNVTDTNTDYLEKEIVVTGSFGQVQE
EEPYRFFGHFVDHPRYGRQFQVDSYQQERPTSASGVVNYLSSDKFPGIGKRTAEKIVEVL
GESAIDRIIDDPSVLEEVTVLNEKKRQVIVETIRLNHGMEQVIVGLNRYGFGSQLAFSIY
QTYQEETLSVIQENPYQLVEDIEGVGFKRADNIAEQIGIQADSAVRIRAAILHEVFEHSI
RSGNTYVQADVLLEEAIRTLEASRPVEISPDQVANEIITLVEHGKIQQEETKLFENSLYF
SEWGIGTSIQRLLSRKKEIHYEEEEVQKNIRMIEKRLNIQYGDSQQAAIEEAIKSPLFIL
TGGPGTGKTTVINGIVSLFAELNGLSLDLKDYTQEMFPILLAAPTGRAAKRMNETTGLPA
STIHRLLGLTGREKNPSLTAKELEGGLLIVDEMSMVDTWLANTLLKAIPTNMQVIFVGDK
DQLPSVGPGQVLHDLLQINEIPKCELNEIYRQGDGSSIIPLAHEIKEGKLPADFQKNQKD
RSFFASDIGHIEEYIRQIVTKAKAKGFTPQDIQVLAPMYRGAAGIDALNKMMQEIFNPND
GKKKEVKWNDTVYRIGDKVLQLVNTPELNVFNGDMGEIVGITLAKDSEDKVDELVLQFDN
NEVTYKRNEWNKITLSYCCSIHKAQGSEFRMVLLPMVHQYSRMLQRNLLYTAVTRSKELL
ILLGEVSAFETCVKNESASRMTMLKERIVNAEQMTLTTRTQLEAYEEGLTADHPFTEKET
KAVSYETEQQSTKANQIKETDEQLVDTMVQEVSLFADEGEESTPETANKATKVVEEPLPK
EPRLTVEIIQTNAVDPMIGMKDTTPYQFM
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
gtggtaacactttttggtgaggacgaagaaaaagcctttattgttggaactgtacaagca
atcttttttgaaaatcccagtaatttttataaagtcgttcttgtaaatgtgaccgataca
aatacagattatttagaaaaagaaattgtagtaactggtagttttggccaagttcaagaa
gaggaaccctatcgtttctttggtcattttgtggaccatcctcgttatggcagacagttt
caggtggatagttatcagcaagaaagaccgacttcggctagtggggtggttaactattta
tcaagtgacaaatttcctggcattggtaaacgaactgctgaaaaaattgttgaagtatta
ggggaaagtgcgattgaccgaattattgatgatccgagtgttttggaagaagttactgtt
ttaaatgaaaaaaaacgtcaagtaatcgtcgaaacaattcgcttgaatcacgggatggag
caagtgattgtgggactaaatcgatacggcttcggtagtcagttagctttttcaatttat
caaacctatcaagaagaaaccctttctgtgattcaagaaaatccttatcagttagttgaa
gatattgagggagtcggatttaaacgagcggacaatattgctgaacaaatcggcattcag
gcggattctgctgttcgaattcgagcggcgattttacatgaagtgtttgagcactccatt
cgctcaggcaatacgtatgttcaagcagatgttttgttagaagaagcgattcggaccttg
gaagcaagtcgcccagtggaaatctcacctgatcaagtggctaatgaaatcattacgtta
gtcgaacatggaaaaatccaacaagaagagactaaactttttgagaacagtctctatttt
tctgaatggggcattggtacttcgattcagcgtttactttctcgtaaaaaagaaattcat
tatgaggaagaagaagtccaaaaaaatatccgaatgattgagaaacgtttaaatattcag
tatggcgactcgcaacaagcagcgattgaagaagcgattaaatcgccgttatttatttta
actggagggcccggaacagggaaaacaactgttattaatgggattgtctcgttgtttgcg
gagctaaatggtctttcattagatctcaaagactatacgcaggagatgtttccaatcttg
ctagcggcgccaactgggcgagcagcgaaacgtatgaacgaaacgacaggtttacctgca
agtaccatccatcgtttgttaggcttgacaggtcgtgaaaaaaatccgagtttaaccgcc
aaagaattagaaggtggtttgctaattgtagatgaaatgtccatggtagatacttggtta
gccaatacgttattaaaagctattccgacaaacatgcaagtgatttttgttggtgataag
gatcagctaccgtctgtcggtccaggtcaagtcttacatgacttattgcaaattaacgaa
attcccaaatgtgagttaaacgaaatttatcgtcaaggagacggttcaagtattattcct
cttgcccatgaaattaaagaaggaaagttgcctgctgattttcaaaaaaatcaaaaggat
cgctcgttctttgcaagtgatattggtcatatcgaagaatacattcgacaaatcgtcaca
aaggcaaaagcaaaagggtttacgccacaagatatccaagttttagcgccaatgtatcgt
ggcgcagccggcattgatgccttgaataagatgatgcaagaaatcttcaatccaaatgat
ggtaagaaaaaagaagtcaaatggaatgacaccgtctatcggattggggacaaagttttg
caactagtcaatacgccagaattaaatgtgttcaatggagatatgggagaaatcgtcgga
attactttagccaaagactcagaggacaaagtggacgagttggttttacagtttgataat
aatgaagtaacgtataaaagaaatgaatggaataaaattacgttatcctattgttgttcg
attcataaagcgcaaggtagtgaattccgcatggtgttactgccaatggttcatcagtat
agccgaatgctgcaacgaaatttgctgtatacagcagtgacacgtagtaaagaattatta
attctattaggtgaggtttctgcttttgaaacatgtgtcaaaaacgaatcggctagtcgc
atgacgatgctaaaagaacgaatcgtgaatgcagaacaaatgaccttaacgactagaacc
cagttagaagcctatgaagaaggtttaacggcagaccatccatttactgaaaaggaaaca
aaagctgtctcttatgaaactgaacagcaatcaacgaaagccaatcagataaaagaaaca
gacgagcaattagttgacacaatggtacaagaagtttcactatttgctgatgaaggggaa
gagtcaaccccagaaacagcaaataaagcgacaaaagttgtcgaagaaccattaccaaaa
gaaccacgactaacagtcgaaattattcaaacaaatgctgttgatccaatgattggaatg
aaggatacgacgccttatcaatttatgtga

DBGET integrated database retrieval system