KEGG   Edwardsiella ictaluri: NT01EI_0336Help
Entry
NT01EI_0336       CDS       T00912                                 

Definition
(GenBank) hypothetical protein
Organism
eic  Edwardsiella ictaluri
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraG-D_C TrwB_AAD_bind T4SS-DNA_transf DUF87 CobU AAA_22
Motif
Other DBs
NCBI-ProteinID: ACR67578
UniProt: C5BCX2
Position
338708..340561
Genome map
AA seq 617 aa AA seqDB search
MSAGQIPVSGQRLFLGRGFRWTQKHTQRLQDTLRPEVAKYLQPGRLYLAARWLEMKTEHS
APGLGKLLRTDSPLNPVRPLPPVGGNPVLHGIEPDEQDVWLALLERVGHTIVYGTTRVGK
TRLAELLVTQDIRRGEVTIVFDPKGDADLMKRVWAEAHRADRGDALYIFHLGWPEISARY
NAVGRFGRVSEVASRVAGQLSGEGNSAAFREFAWRFVNIIARALVALGERPDYTLIMRYV
NNIADLYIRYAEKVIREQLPSLQAQIQNNEQVLGDDDVPRNMQGQPDAVRIWSIEVALSS
EEGKQLYDPILDGLRSAVRYDRTYFDKIVASLLPLLEKLTTGKTAELLAPDYLEMSDSRP
IFDWEQIIRKKAVVYIGLDALSDSEVASAVGNSMFADLVSVAGHIYKHGIHAGLPGEGES
KVPVNLHCDEFNELMGDEFIPLINKGGGAGMQVTAYTQTSSDIEARIGNAAKTAQVQGNF
NNLIMLRVRENRTAELLTTQLPQVEIYTKTLVSGHQDTDISAGQDFTSSTQDRVGTVKVP
LLEPADVVTLPKGQAFALLEGGQLWKIRMPLPADDADDTLMPQSIAKIAEEMRRNYHSGE
AWWNDAPGIVPAGGVRG
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgggcagataccggtcagtggtcagcgcctgtttttggggcgcgggtttcgc
tggacacaaaaacatacccagcgactgcaggatacgctgcgcccggaagtggcgaagtac
ctgcagccgggtcggctatatctggccgctcgctggctggaaatgaagacggagcattca
gcgccgggtctgggaaaactgctgcgcacggattcgcccctgaacccggttcgcccgctg
ccgccggttggtggtaatccggtgctgcacggcatagagccggatgagcaggatgtctgg
ctggcgttgctggagcgtgtcgggcataccatcgtctatggcaccacccgtgtgggaaaa
acacgcctggcggagctgctggttacccaggatattcgtcgcggtgaagtcaccattgtt
tttgatccgaagggcgatgccgatctgatgaagcgcgtctgggctgaagcacaccgtgcc
gacaggggggatgcgctgtatattttccatctgggctggcctgaaatctccgcccgctat
aacgctgtcggacgttttggccgggtgtcagaagtggcgtcccgcgtggcgggccaactg
tcgggggaggggaacagcgcggcgttccgtgagtttgcctggcggtttgtcaacattatc
gcccgggccctggtagcactgggtgagcgtccggattacacgctgattatgcggtatgtg
aacaatatcgccgatctgtatatccgttatgcagagaaggttatccgtgagcagcttccc
tcactgcaggcacaaattcagaataacgagcaggttctgggggatgacgatgttccacgg
aatatgcaggggcagccggatgcggtgcgcatatggtccatagaggtggcgctcagctcg
gaagagggaaagcagctgtatgatcccattctggatggtctgcgtagcgcagtacgctat
gaccgtacctattttgataaaattgtggcctccctgctgcctctgctggagaaactgaca
accgggaaaaccgcagagttgctggcgccggattatctggagatgagcgattcacggccg
atttttgactgggagcagataatccgcaaaaaggcagtggtgtatattggccttgatgca
ctcagcgacagtgaagtggccagcgccgtggggaattccatgttcgccgatctggtgagc
gtggccggtcatatctacaagcatggtattcatgccggactgccgggagagggtgagagc
aaggttccggttaacctgcattgtgatgaatttaatgagttgatgggtgatgaatttatc
ccgcttattaacaaagggggcggcgccggtatgcaggtaaccgcttatacccagacctca
tcggatattgaggcccggatcggtaatgcggccaaaacggctcaggtccagggcaacttc
aacaatctgattatgttacgtgtcagggagaaccgtaccgctgagctcctgactacgcaa
ttgccgcaggtagagatttacaccaagacgctggtctctggccatcaggataccgatatc
agtgcgggtcaggattttacctccagtacgcaggatcgtgtcgggacggtcaaagtaccg
ttgctagagccggctgatgtggtaacactaccgaaagggcaggcgttcgccctgctggaa
ggcgggcaactgtggaaaatccgtatgccgctgcctgccgacgatgcggatgatacactg
atgccgcagagcattgcgaaaattgccgaggaaatgcgccgcaattaccacagtggtgag
gcgtggtggaatgatgcgccgggcatcgtgcctgcaggaggtgtgcgtggctga

DBGET integrated database retrieval system