KEGG   Erythrobacter litoralis HTCC2594: ELI_03245
Entry
ELI_03245         CDS       T00315                                 
Name
(GenBank) type IV secretion system protein B11, putative
  KO
K03196  type IV secretion system protein VirB11 [EC:7.4.2.8]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
eli03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eli00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ELI_03245
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eli02044]
    ELI_03245
Enzymes [BR:eli01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     ELI_03245
Secretion system [BR:eli02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   ELI_03245
SSDB
Motif
Pfam: T2SSE AAA_16 TrwB_AAD_bind AAA_7 Dynamin_N AAA_28 ATPase AAA_29 AAA_19 nSTAND3 Guanylate_kin FtsK_SpoIIIE MMR_HSR1 RsgA_GTPase TsaE MoCF_biosynth AAA_23 Zeta_toxin
Other DBs
NCBI-ProteinID: ABC62741
UniProt: Q2NC50
Position
684727..685740
AA seq 337 aa
MSADVHPFAKQAEAAETPLPGDRSVYLEAYLKPFREWLDRDTVTEILVNRPGEVWIEDAA
SPGMQRVDTPHIDDRLVQRLAEQVARVSHQGINREHPLLGATLPDGARVQFCGPPASRKH
WCMAIRRHRRLDLPLDAYDSGPLSPPQEQAMPDAQAEPIAFLREAIRQRRTILISGGTST
GKTTFLNAMLGEIPKEQRVVLVEDTPELRLPGENGVGLVAVKGELGEAKVTANELLQAAL
RLRPDRIVLGELRGAESVSFLRAINTGHPGSFSTIHANSITGALEQLSLMVMQTGIGLSR
SDTIAYASNVIDVIVQLGRSGEGKRGISEIALAKDLV
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgagcgcggacgtccatccctttgcgaaacaggccgaagcggcggaaaccccgctgccg
ggcgatcgcagcgtctatctcgaggcctatctcaagccgttccgcgaatggctcgaccgc
gacacggtgacggaaatactcgtcaaccgccctggcgaagtctggatcgaggatgcagcc
tcgccaggcatgcaacgcgtcgatacgccgcatatcgatgaccggctggtccagcgcctc
gccgaacaggtcgcgcgggtcagccatcagggcatcaaccgcgagcatcccctgctgggc
gcgacattgcccgacggggcgcgggtgcagttctgcggaccgcctgccagccgcaagcat
tggtgcatggcgatccgtcgccaccggcgcctggacctgccgctcgacgcttacgactcc
gggccgctctcaccgccgcaggaacaggccatgcccgatgcgcaggccgagccgatcgcg
tttctgcgcgaagccatccggcagcggcgcacgatcctgatttcgggcggtacgagcacc
ggcaagacgacgttcctcaacgccatgctgggcgaaattcccaaagagcagcgggtcgtt
ctggtcgaggatacgcccgaactgcgtttgccgggcgagaacggcgtcggtctcgtcgca
gtcaagggcgagcttggcgaggcgaaggtcacggccaatgaactgctgcaggcggcgctg
cgcttgcgccccgaccgcatcgtgctgggcgaattgcgcggcgccgaaagcgtcagcttc
ctgcgcgctatcaataccggccacccgggcagtttctcgaccatccacgccaactcgatc
accggcgcgctcgagcaattgtcgctgatggtcatgcagaccggcatcggtcttagccgc
agcgacacgatcgcttatgcctccaacgtgatcgacgtcatcgtccagctcggccgcagc
ggggagggcaagcgcgggataagcgaaatcgcgctcgccaaggacctcgtctag

DBGET integrated database retrieval system