KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_00434
Entry
ECL_00434         CDS       T01231                                 
Name
(GenBank) TraG-family protein
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 AAA_22 TniB
Other DBs
NCBI-ProteinID: ADF60000
UniProt: A0A0H3CFH5
Position
447206..449323
AA seq 705 aa
MSDRYVMESLLRPAVELYSATVAASATCICLTAPWAVALSPSVSWVTAAGFGVLALKRTR
EGMKILRYRQNIRRLPRYVLTSEQIPVSRRHLFLGKGFQWSVRHTQRLIEARRPECEIYV
QPSVLYRMAREMEKKMEYSLPWLCRLTCTDSALNPFRPLPPVGGSPVYHGVEPDETTVTY
DLGERVGHMLVIGTTRVGKTRLAELLITQDIRRTNAAGEHEVVIVFDPKGDADLLRRMYA
ESHRAGRQDNFWVFHLGWPDISARYNAVGRFSRISEVASRVAGQLSGEGNSAAFREFAWR
FVNIITRALVALGQRPDYGLILRYVTNIGELYETYVDNLLSEKAPQLMNTTEAMMQSGIS
DKDLPRHLQGRPNGVKIWVSEQVLGSPEGKKLWDPVLDGLRSAVQYDRTYFDKIVASLLP
LLEKLTTGKTAALLAPDYTDLDDPRPILDWHNIIKSRGVVYVGLDALSDPVVAAAVGNSM
FADLVSEGGHIYKFGLGDEEEGKSAKVAINLHCDEFNELMGDEFIPLINKGGGAGFQVTA
YTQTLSDIEARIGSTAKANQVVGNFNTLVMLRVREKNTAMLLTDQLPEVDVYQKTLTSGV
TDVSRPGEGTDFNSNVNDQVSLVKVPMIRPADIINLPKGQAFALLEGGRLWKIRMPLPAD
NNDPHMPASLKHLADSMEKNYHTGETWWTGGDITYAGGPDATAGQ
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgagcgatcgctatgtgatggaatccctgctgcgcccggctgtggaactgtattccgca
acggttgcggccagtgcgacctgtatctgcctgaccgccccgtgggcggtggcactctcg
ccttctgtcagttgggtgacggccgccggtttcggcgttctggccctgaagcgcacccgc
gagggcatgaaaattctgcgctaccggcagaatatccgccgtcttccccgttatgtactg
accagcgaacagataccggtcagccggcgccatctgtttctggggaaaggttttcagtgg
tctgtgcgtcatacccagcggctgattgaggcgcgtcggccggagtgcgaaatctatgtg
cagccctccgtgctgtaccgcatggcgcgtgagatggaaaagaagatggagtacagcctc
ccctggctgtgccggctgacctgcacggattcggcgctgaacccttttcgccctttaccc
ccggtcggcggcagcccggtgtatcacggtgtcgagcctgatgagactacggtgacctac
gatctcggcgaacgcgtcgggcatatgctcgttatcggcacgacccgcgtgggcaagacc
cgactggcggaactgcttatcacccaggatatccgccgcacaaacgccgccggtgaacac
gaggtggtcattgtgtttgaccctaaaggggacgcggacctgctccggcggatgtacgca
gagtcgcaccgcgcggggcgtcaggataacttctgggtgttccacctcggctggcccgat
atcagcgcccggtataacgccgtcggacggttcagccgtatctccgaggtggcctcccgc
gtggccggtcagctctcgggggaaggtaactccgcggccttccgtgaatttgcctggcgg
ttcgtcaatatcatcacccgcgcgctggtcgccctcggacaacgcccggactacggcctc
attctgcggtatgtcaccaatatcggtgagctgtatgagacttacgtggataacttgctg
agcgaaaaggcgccgcagctgatgaatacaacggaagccatgatgcagagcgggatcagc
gataaggacctgccgcgtcatctccagggacggcctaacggcgtgaaaatctgggtgtca
gagcaggtgctcggcagcccggaggggaaaaaactctgggacccggtgctggacggcctg
cgcagcgcggtgcagtacgatcgcacctacttcgataaaattgtggcatccctgttacca
ctactggagaaactcactaccggcaaaacggccgcgcttctcgccccagactacaccgac
ctggacgatccgcgtccgattctcgactggcacaatatcatcaagtcccgaggcgtggta
tacgtgggcctcgatgcactctccgacccggtggtggccgccgccgttggaaacagcatg
ttcgcagacctcgtgtctgagggaggccacatctataagttcggtctcggtgatgaggaa
gaggggaaatccgcaaaggtggccatcaaccttcactgcgatgagtttaacgagctgatg
ggggatgaatttatcccgcttattaacaaaggcggtggtgccggttttcaggtgacggct
tacacccagacgctttctgacatcgaggcccgcatcggcagtacggccaaagcgaaccag
gtggtgggtaacttcaacactctggtgatgctgcgcgtgcgcgagaaaaacaccgccatg
ctgctcaccgatcagctcccggaagtggatgtctaccagaaaacactgacatcgggtgtc
accgacgtctcgcgtcccggggaaggcacggattttaacagcaacgttaacgaccaggtg
agtctggtaaaagtgccgatgataagacctgctgacatcatcaatctgccgaaaggccag
gcctttgcactgctggaagggggaagactgtggaaaatccgtatgccgttgccggcggat
aacaacgacccacatatgccggccagcctgaagcatctggctgacagcatggagaaaaac
taccacaccggtgaaacctggtggaccggtggtgacataacgtatgcaggagggccggat
gccacagcaggacagtga

DBGET integrated database retrieval system