KEGG   Edwardsiella piscicida C07-087: ETAC_00960Help
Entry
ETAC_00960        CDS       T02509                                 

Gene name
dpiB
Definition
(GenBank) sensor histidine kinase DpiB
  KO
K07700  two-component system, CitB family, cit operon sensor histidine kinase CitA [EC:2.7.13.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00486  CitA-CitB (citrate fermentation) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_00960 (dpiB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etc01001]
    ETAC_00960 (dpiB)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_00960 (dpiB)
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ETAC_00960 (dpiB)
Protein kinases [BR:etc01001]
 Histidine kinases
  CitB family [OT]
   ETAC_00960 (dpiB)
Two-component system [BR:etc02022]
 CitB family
  CitA-CitB [MD:M00486]
   ETAC_00960 (dpiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: sCache_3_2 HATPase_c HATPase_c_5 SPOB_a PAS PAS_4 HATPase_c_3 HATPase_c_2 PAS_9 PAS_8 PAS_2 PAS_7 HemY_N DUF1803
Motif
Other DBs
NCBI-ProteinID: AGH72325
Position
234689..236323
Genome map
AA seq 544 aa AA seqDB search
MPNNSAVNFFRRMAFPLRIFLLLLLVSCCLFAALGKYLSASFEDYMMRQVRDMAMNQAKI
IASMDSIVDGVKDRDTRRLALIADRLGTGTDFDYVVIGDRNAIRLYHPNPAKIGHKMQFN
KPGAIEKGESYFISGKGSLGQALRAKTPIFDHQGQVIGVVSLGYLVSKIDSWRLDFLLPM
AGVFVCVLLLLMLLSWLFAAHIRRQMMGMEPRQIARVVRQMEALFGAVFEGLIAVDPDGQ
ITAINRNARKMLGLSAPGRQWLGQPISQVVSPSGFFTDRINEDRRDAILTFNGLSVIANR
ATIRSDDGDTLLGAIISFRSKDDINTLNAQLTQIRQYVDSLRTVRHEHLNWMSTLSGLLQ
MKEYDRALEMVRGASQAQQQLIDRLRDAFSDKVVAGLLFGKVHRARELGLTLTIVDGSQL
HALPAGLDSTEFAAVLGNLLDNAFDASLKNPQGGGCVEVYLSDEGSEVIIEVADQGCGVP
DTLKDKIFEQGVSTKAEEPGEHGIGLYLIARYVGRCGGTITLEDNQPYGTLFSVFIPKVK
SEHE
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgccgaataacagtgcggtgaatttctttcgccgtatggcgttccccctgcgtattttt
ttactgttactgctggtttcctgctgcctgtttgccgccctggggaagtacctgtcagcc
agctttgaagactacatgatgaggcaggtgcgtgatatggcgatgaaccaggccaagatc
atcgcatcgatggacagcatcgtggatggggtgaaggatcgcgatacccgccgtttagcg
ctgattgccgatcgtctaggaaccgggactgactttgactatgtggtcatcggcgatcgg
aacgctattcgtctgtatcaccccaatccggctaaaatcggccacaagatgcagttcaat
aagccgggcgccattgaaaagggcgagagctactttatctcaggcaaaggctctctgggc
caggcgctgcgcgcgaaaacgcccattttcgatcatcaggggcaggtgatcggggtcgtt
tccctgggctatctggtcagcaagatcgatagctggcgcctggactttctgctgcccatg
gccggggtcttcgtgtgcgtgctgctgctgctgatgctgctctcctggctatttgccgcg
catatccgacgacagatgatggggatggagccgcgccagatagcccgggtggtgcgtcag
atggaggccctgttcggcgcggtctttgagggcctgattgcggtcgatcctgacggacag
atcacggcaataaatcgcaatgctcgcaaaatgctggggctaagcgcgccgggtcgccag
tggctggggcagccgataagccaggtggtttcgccgtcgggctttttcaccgatcgcatc
aatgaagatcggcgcgatgccattctcacctttaacgggctgagcgtgatagccaaccgg
gcgaccatccgctccgacgacggcgatacgctgctcggcgcgattatcagcttccgtagc
aaggatgatatcaatacgcttaacgcccagctgacccagatccgtcagtatgtcgacagc
ctgcgcaccgtgcgccatgagcacctcaactggatgtcgacgctaagcgggctgctgcag
atgaaggagtacgatcgggcgctggagatggtgcgcggtgcatcgcaggcgcagcagcag
ctgatcgaccgtctgcgcgatgcgttcagcgacaaggtggtcgccgggctgctgtttggt
aaagtgcatcgggcgcgcgagctggggctgacgctgaccatcgtcgacggcagccagctg
catgcgctgccggcggggctggacagcacggagtttgcggcggtattgggcaatctattg
gataatgccttcgatgccagtttgaagaacccacaggggggcggctgcgtggaggtctat
ctgtcggatgagggcagcgaggtcatcattgaagtggccgatcagggctgcggcgtcccg
gataccctgaaagacaaaatttttgagcagggcgtgagcaccaaggcggaagagccgggg
gagcacggcattggcctgtaccttattgcccgctatgtcgggcgttgcggaggcaccatt
acgctggaggacaaccagccctatggcactctattttctgtttttatcccgaaggtgaag
agtgaacatgaataa

DBGET integrated database retrieval system