KEGG   Helicobacter pylori PeCan4: HPPC_02695
Entry
HPPC_02695        CDS       T01322                                 

Definition
(GenBank) cag pathogenicity island protein E
  KO
K12108  cag pathogenicity island protein 23 [EC:7.4.2.8]
Organism
hpc  Helicobacter pylori PeCan4
Module
hpc_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpc02044]
    HPPC_02695
Enzymes [BR:hpc01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     HPPC_02695
Secretion system [BR:hpc02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HPPC_02695
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_10 FtsK_SpoIIIE AAA_23 DUF87 AAA_7 TrwB_AAD_bind AAA_29 T2SSE
Other DBs
NCBI-ProteinID: ADO06777
UniProt: E1Q634
Position
complement(529722..532673)
AA seq 983 aa
MFVASKQADEQKKLIIEQEVQKRQFQKIEELKADMQKGVNPFFKVLFDGGNRLFGFPETF
IYSSIFILFVTVVLSVILFQAYEPVLIVAIVIVLVALGFKKDYRLYQRMERAMKFKKPFL
FKGVKNKAFMSIFSMKPSKEMANDIHLNPNREDRLVSAANSYLANNYECFLDDGVILTNN
YSLLGTIKLGGIDFLTTSKKDLIELHASIYSVFRNFVTPEFKFYFHTIKKKIVIDETNRD
YGLAFSNDFMRAYNEKQKRESFYDISFFLTIEQDLLDTLNEPVMNKKHFADNNFEEFQRI
IRAKLENFKDRIELIEELLSKYHPTRLKEYIKDGVVYSKQCEFYNFLVGMNEAPFICNRK
DLYLKEKMHGGVKEVYFANKHGKILNDDLSEKYFSAIEISEYAPKSQSDLFDKINALDSE
FIFMHAYSPKNSQVLKDKLAFTSRRIIISGGSKEQGMTLGCLSELVGNGDITLGSYGNSL
VLFADSFEKMKQSVKECVSSLNAKGFLANAATFSMENYFFAKHCSFITLPFIFDVTSNNF
ADFIAMRAMSFDGNQENNAWGNSVMTLKSEINSPFYLNFHMPTDFGSASAGHTLILGSTG
SGKTVFMSMTLNAMGQFAYNFPANVSKDKQKLTMVYMDKDYGAYGNIVAMGGEYVKIELG
TDTGLNPFAWAACVQKTNATMEQKQTAISVVKELVKNLATKSDEKDENGNSISFSLADSN
TLAAAVTNLITGDMNLDYPITQLINAFGKDHNDPNGLVARLAPFCKSTNGEFQWLFDNKA
TDRLDFSKTIIGVDGSSFLDNNDVSPFICFYLFARIQEAMDGRRFVLDIDEAWKYLGDPK
VAYFVRDMLKTARKRNAIVRLATQSITDLLACPIADTIREQCPTKIFLRNDGGNLSDYQR
LANVTEKEFEIITKGLDRKILYKQDGSPSVIASFNLRGIPKEYLKILSTDTVFVKEIDKI
IQNHSIIDKYQALRQMYQQIEEY
NT seq 2952 nt   +upstreamnt  +downstreamnt
gtgtttgtggcaagcaaacaagctgacgaacaaaaaaagctaatcatagagcaagaggtt
caaaagcggcagtttcaaaaaatagaagagcttaaagcagacatgcaaaaaggtgtcaat
cccttttttaaagtcttgtttgatggggggaatagattgtttggtttccctgaaactttt
atttattcctccatatttatattatttgtaacagttgtattatctgttattctttttcaa
gcttatgaacctgttttgattgtagcgattgttattgtgcttgtagctcttggattcaag
aaagattataggctttatcaaagaatggagcgagcgatgaaatttaaaaaaccttttttg
tttaagggcgtgaaaaacaaagcattcatgagcattttttccatgaagcctagtaaagaa
atggctaatgacatccacttaaatccaaacagagaagacagacttgtgagtgctgcaaac
tcctatttggcgaataactatgaatgttttttagatgatggggtgatccttactaacaac
tattctcttttaggcacaatcaaattggggggcattgattttttaaccacttccaaaaaa
gatctcatagagttacacgcttctatttatagcgtttttaggaattttgttacccctgaa
ttcaaattttattttcacactattaaaaagaaaatcgttattgatgaaaccaatagggat
tatggtcttgctttttctaatgatttcatgcgagcctataatgagaagcaaaagagagaa
agtttttatgatattagtttttttctcaccatagagcaagatttattagacactctcaat
gaacccgttatgaataaaaagcattttgcagacaataattttgaagagtttcaaaggatt
attagagccaagcttgaaaacttcaaggataggatagagcttatagaagagctattgagt
aaataccaccccactagattaaaagaatatattaaagatggggttgtttattccaaacaa
tgcgagttttacaattttcttgtgggaatgaatgaagccccttttatttgcaacagaaaa
gacttgtatctcaaggaaaaaatgcatggtggggtgaaagaagtttattttgccaataag
catggaaaaatcttaaatgatgatttgagtgaaaaatattttagcgctattgagattagt
gaatacgcccctaaatcacagagcgatttgtttgacaagatcaacgctctagacagcgaa
tttatctttatgcatgcttattcgcctaaaaactcacaggttttaaaggacaaactagct
ttcacctctagaaggattattattagtgggggctctaaagagcagggcatgactttaggt
tgcttgagcgaattagtgggtaatggtgatattacgctaggcagttatggtaattcttta
gtgctgtttgctgatagctttgaaaaaatgaaacaaagcgtcaaggaatgcgtctctagt
cttaacgctaaaggttttttagccaacgcagcgactttctctatggaaaattactttttt
gccaaacattgctcttttattacgcttccttttatttttgatgtaacttctaataatttt
gctgattttatcgctatgagagcgatgagttttgatggcaatcaagagaataacgcttgg
ggtaatagcgtcatgacgctaaaaagcgagatcaattcgcctttttatctgaacttccac
atgcccactgattttggttcagcttcagcaggacacactttgatacttggctcaaccggt
tcaggtaagacagtgtttatgtcaatgaccttgaacgctatggggcaatttgcctataat
tttcctgctaatgtcagcaaagacaagcaaaagctcactatggtctatatggataaagat
tatggcgcttatgggaatattgtcgcaatgggtggggagtatgtcaagattgagctaggg
acagatacaggattaaatccttttgcttgggcggcttgtgtgcaaaaaacaaatgcaaca
atggagcaaaaacaaacagctatttctgttgtcaaagagcttgtgaaaaacttagcaacc
aaaagcgatgaaaaagatgaaaatggcaacagcatctcttttagcctagcagattctaat
acgcttgcagcggcagtaaccaaccttatcacaggagatatgaacctagattatcctatc
actcaacttattaatgctttcggaaaagaccacaatgatcctaatgggcttgtcgcgcga
ttagcacctttttgcaaatcaaccaatggtgaatttcaatggctttttgacaataaagca
acagatcgcttagatttttcaaaaacgattattggcgttgatgggtcaagtttcttagac
aataatgatgtttcgccctttatttgtttttaccttttcgctcgtatccaagaggcaatg
gatgggcgtagatttgtcttggatattgatgaagcttggaaatatttaggcgatccaaag
gtcgcttattttgtaagagacatgctaaaaactgcaaggaaaagaaacgctattgtcagg
cttgcgactcaaagcatcactgatcttttggcttgccctattgctgatacgattagagaa
caatgccctacaaagatttttttaagaaacgatgggggcaatctttctgattaccaaaga
ttggctaatgttacagaaaaagaatttgaaatcatcactaagggactagataggaaaatt
ctctacaaacaagatggaagccctagcgttatcgctagttttaatttgagaggcattcct
aaagaatatttgaaaattttatccacagatactgtatttgtcaaagaaattgacaagatt
atccaaaaccatagtatcatagataaatatcaggccttgaggcaaatgtatcaacaaata
gaggagtattaa

DBGET integrated database retrieval system