KEGG   Helicobacter pylori G27: HPG27_970
Entry
HPG27_970         CDS       T00777                                 
Name
(GenBank) type IV secretion system ATPase (virB11-like)
  KO
K03196  type IV secretion system protein VirB11 [EC:7.4.2.8]
Organism
hpg  Helicobacter pylori G27
Pathway
hpg03070  Bacterial secretion system
hpg05120  Epithelial cell signaling in Helicobacter pylori infection
Module
hpg_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HPG27_970
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    HPG27_970
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpg02044]
    HPG27_970
Enzymes [BR:hpg01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     HPG27_970
Secretion system [BR:hpg02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   HPG27_970
SSDB
Motif
Pfam: T2SSE AAA_7 FtsK_SpoIIIE AAA_16 nSTAND3 SRPRB AAA_14 Zeta_toxin AAA_29 TsaE TrwB_AAD_bind
Other DBs
NCBI-ProteinID: ACI27723
UniProt: B5Z824
Position
1058237..1059178
AA seq 313 aa
MISNLLKSYLDDFMPILSQPNLNEVVFNKEKEYFLHRPKEKVRCFNEKFTNDYLLVFCEQ
LAIFRNQKFTLKTPKLNTSLPYTQIRINALHPSIIASSNISINIRVPSNFKFEINAFKLS
EKCLAKNITYDFLLNLVSTGKNILISGGTASGKTSFVNSLIENIPKNERVVTIEDSPELK
ISNEDQVNILVDKSGSGFFTYEDGLNAAMRMSPDRLLLGEIDTHNTALFLRLANTGHSGM
ISTLHANSVVDAFIAICQNINLNKGGKPTPKETLLDYFCTGMDYVIQIKKKGSDRIIDDV
LNVKSEFKKELVL
NT seq 942 nt   +upstreamnt  +downstreamnt
atgatttccaatcttttaaaaagttaccttgatgactttatgcctattttaagccagcct
aatttaaatgaagtggtttttaataaagaaaaagagtatttcttgcaccgcccaaaggaa
aaagtgagatgttttaatgaaaaatttactaatgattatttgttagttttttgtgagcaa
ttagccatttttagaaaccaaaaattcactctaaaaacgcctaagttaaacacttctttg
ccttacacgcaaattagaattaacgcattacaccctagcattattgctagttctaatatc
tctatcaatattagagtgcctagcaatttcaagtttgaaattaacgcctttaaattaagt
gagaaatgtctggctaaaaacattacctatgattttttacttaacttagtaagtacaggt
aaaaatattttaataagtggtggcacagctagtggtaagactagctttgttaattctttg
attgaaaatattcccaaaaacgaaagggtggttactattgaagatagtcctgagttgaaa
atcagtaacgaagaccaagttaatattttagtggataaaagtgggagcggattttttact
tatgaagatggcttaaatgcggctatgagaatgtctcctgatagattattattaggcgaa
attgacacgcataacactgcgttatttttgcgtttagcaaatactgggcatagcggaatg
ataagcaccttacatgctaatagtgtagtagatgcttttatagctatttgtcagaatatc
aacttgaataaaggcggtaagcctacgcctaaagaaacgcttttagattatttttgcact
ggtatggactatgttatccaaatcaaaaaaaaaggtagcgataggataattgatgatgtt
ttaaatgttaaaagcgaatttaaaaaggagttggtgttatga

DBGET integrated database retrieval system