KEGG   Homo sapiens (human): 10021
Entry
10021             CDS       T01001                                 

Gene name
HCN4, SSS2
Definition
(RefSeq) hyperpolarization activated cyclic nucleotide gated potassium channel 4
  KO
K04957  hyperpolarization activated cyclic nucleotide-gated potassium channel 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04742  Taste transduction
Disease
H00728  Brugada syndrome
H00729  Sick sinus syndrome
Drug target
Ivabradine (DG00246): D07165 D08095<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    10021 (HCN4)
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    10021 (HCN4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    10021 (HCN4)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (HCN)
   10021 (HCN4)
SSDB
Motif
Pfam: Ion_trans Ion_trans_N cNMP_binding Ion_trans_2
Other DBs
NCBI-GeneID: 10021
NCBI-ProteinID: NP_005468
OMIM: 605206
HGNC: 16882
Ensembl: ENSG00000138622
Vega: OTTHUMG00000137563
Pharos: Q9Y3Q4(Tclin)
UniProt: Q9Y3Q4
Structure
PDB: 

Position
15q24.1
AA seq 1203 aa
MDKLPPSMRKRLYSLPQQVGAKAWIMDEEEDAEEEGAGGRQDPSRRSIRLRPLPSPSPSA
AAGGTESRSSALGAADSEGPARGAGKSSTNGDCRRFRGSLASLGSRGGGSGGTGSGSSHG
HLHDSAEERRLIAEGDASPGEDRTPPGLAAEPERPGASAQPAASPPPPQQPPQPASASCE
QPSVDTAIKVEGGAAAGDQILPEAEVRLGQAGFMQRQFGAMLQPGVNKFSLRMFGSQKAV
EREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNV
VSDTFFLIDLVLNFRTGIVVEDNTEIILDPQRIKMKYLKSWFMVDFISSIPVDYIFLIVE
TRIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVN
LIGMMLLLCHWDGCLQFLVPMLQDFPDDCWVSINNMVNNSWGKQYSYALFKAMSHMLCIG
YGRQAPVGMSDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSF
HKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANAD
PNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGE
ICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSI
LLHKVQHDLNSGVFNYQENEIIQQIVQHDREMAHCAHRVQAAASATPTPTPVIWTPLIQA
PLQAAAATTSVAIALTHHPRLPAAIFRPPPGSGLGNLGAGQTPRHLKRLQSLIPSALGSA
SPASSPSQVDTPSSSSFHIQQLAGFSAPAGLSPLLPSSSSSPPPGACGSPSAPTPSAGVA
ATTIAGFGHFHKALGGSLSSSDSPLLTPLQPGARSPQAAQPSPAPPGARGGLGLPEHFLP
PPPSSRSPSSSPGQLGQPPGELSLGLATGPLSTPETPPRQPEPPSLVAGASGGASPVGFT
PRGGLSPPGHSPGPPRTFPSAPPRASGSHGSLLLPPASSPPPPQVPQRRGTPPLTPGRLT
QDLKLISASQPALPQDGAQTLRRASPHSSGESMAAFPLFPRAGGGSGGSGSSGGLGPPGR
PYGAIPGQHVTLPRKTSSGSLPPPLSLFGARATSSGGPPLTAGPQREPGARPEPVRSKLP
SNL
NT seq 3612 nt   +upstreamnt  +downstreamnt
atggacaagctgccgccgtccatgcgcaagcggctctacagcctcccgcagcaggtgggg
gccaaggcgtggatcatggacgaggaagaggacgccgaggaggagggggccgggggccgc
caagaccccagccgcaggagcatccggctgcggccactgccctcgccctccccctcggcg
gccgcgggtggcacggagtcccggagctcggccctcggggcagcggacagcgaagggccg
gcccgcggcgcgggcaagtccagcacgaacggcgactgcaggcgcttccgcgggagcctg
gcctcgctgggcagccggggcggcggcagcggcggcacggggagcggcagcagtcacgga
cacctgcatgactccgcggaggagcggcggctcatcgccgagggcgacgcgtcccccggc
gaggacaggacgcccccaggcctggcggccgagcccgagcgccccggcgcctcggcgcag
cccgcagcctcgccgccgccgccccagcagccaccgcagccggcctccgcctcctgcgag
cagccctcggtggacaccgctatcaaagtggagggaggcgcggctgccggcgaccagatc
ctcccggaggccgaggtgcgcctgggccaggccggcttcatgcagcgccagttcggggcc
atgctccaacccggggtcaacaaattctccctaaggatgttcggcagccagaaagccgtg
gagcgcgaacaggagagggtcaagtcggccggattttggattatccacccctacagtgac
ttcagattttactgggacctgaccatgctgctgctgatggtgggaaacctgattatcatt
cctgtgggcatcaccttcttcaaggatgagaacaccacaccctggattgtcttcaatgtg
gtgtcagacacattcttcctcatcgacttggtcctcaacttccgcacagggatcgtggtg
gaggacaacacagagatcatcctggacccgcagcggattaaaatgaagtacctgaaaagc
tggttcatggtagatttcatttcctccatccccgtggactacatcttcctcattgtggag
acacgcatcgactcggaggtctacaagactgcccgggccctgcgcattgtccgcttcacg
aagatcctcagcctcttacgcctgttacgcctctcccgcctcattcgatatattcaccag
tgggaagagatcttccacatgacctacgacctggccagcgccgtggtgcgcatcgtgaac
ctcatcggcatgatgctcctgctctgccactgggacggctgcctgcagttcctggtaccc
atgctacaggacttccctgacgactgctgggtgtccatcaacaacatggtgaacaactcc
tgggggaagcagtactcctacgcgctcttcaaggccatgagccacatgctgtgcatcggc
tacgggcggcaggcgcccgtgggcatgtccgacgtctggctcaccatgctcagcatgatc
gtgggtgccacctgctacgccatgttcattggccacgccactgccctcatccagtccctg
gactcctcccggcgccagtaccaggaaaagtacaagcaggtggagcagtacatgtccttt
cacaagctcccgcccgacacccggcagcgcatccacgactactacgagcaccgctaccag
ggcaagatgttcgacgaggagagcatcctgggcgagctaagcgagcccctgcgggaggag
atcatcaactttaactgtcggaagctggtggcctccatgccactgtttgccaatgcggac
cccaacttcgtgacgtccatgctgaccaagctgcgtttcgaggtcttccagcctggggac
tacatcatccgggaaggcaccattggcaagaagatgtacttcatccagcatggcgtggtc
agcgtgctcaccaagggcaacaaggagaccaagctggccgacggctcctactttggagag
atctgcctgctgacccggggccggcgcacagccagcgtgagggccgacacctactgccgc
ctctactcgctgagcgtggacaacttcaatgaggtgctggaggagtaccccatgatgcga
agggccttcgagaccgtggcgctggaccgcctggaccgcattggcaagaagaactccatc
ctcctccacaaagtccagcacgacctcaactccggcgtcttcaactaccaggagaatgag
atcatccagcagattgtgcagcatgaccgggagatggcccactgcgcgcaccgcgtccag
gctgctgcctctgccaccccaacccccacgcccgtcatctggaccccgctgatccaggca
ccactgcaggctgccgctgccaccacttctgtggccatagccctcacccaccaccctcgc
ctgcctgctgccatcttccgccctcccccaggatctgggctgggcaacctcggtgccggg
cagacgccaaggcacctgaaacggctgcagtccctgatcccttctgcgctgggctccgcc
tcgcccgccagcagcccgtcccaggtggacacaccgtcttcatcctccttccacatccaa
cagctggctggattctctgcccccgctggactgagcccactcctgccctcatccagctcc
tccccaccccccggggcctgtggctccccctcggctcccacaccatcagctggcgtagcc
gccaccaccatagccgggtttggccacttccacaaggcgctgggtggctccctgtcctcc
tccgactctcccctgctcaccccgctgcagccaggcgcccgctccccgcaggctgcccag
ccatctcccgcgccacccggggcccggggaggcctgggactcccggagcacttcctgcca
cccccaccctcatccagatccccgtcatctagccccgggcagctgggccagcctcccggg
gagttgtccctaggtctggccactggcccactgagcacgccagagacacccccacggcag
cctgagccgccgtcccttgtggcaggggcctctgggggggcttcccctgtaggctttact
ccccgaggaggtctcagcccccctggccacagcccaggccccccaagaaccttcccgagt
gccccgccccgggcctctggctcccacggatccttgctcctgccacctgcatccagcccc
ccaccaccccaggtcccccagcgccggggcacacccccgctcacccccggccgcctcacc
caggacctcaagctcatctccgcgtctcagccagccctgcctcaggacggggcgcagact
ctccgcagagcctccccgcactcctcaggggagtccatggctgccttcccgctcttcccc
agggctgggggtggcagcgggggcagtgggagcagcgggggcctcggtccccctgggagg
ccctatggtgccatccccggccagcacgtcactctgcctcggaagacatcctcaggttct
ttgccaccccctctgtctttgtttggggcaagagccacctcttctggggggccccctctg
actgctggaccccagagggaacctggggccaggcctgagccagtgcgctccaaactgcca
tccaatctatga

KEGG   Homo sapiens (human): 6326
Entry
6326              CDS       T01001                                 

Gene name
SCN2A, BFIC3, BFIS3, BFNIS, DEE11, EA9, EIEE11, HBA, HBSCI, HBSCII, NAC2, Na(v)1.2, Nav1.2, SCN2A1, SCN2A2
Definition
(RefSeq) sodium voltage-gated channel alpha subunit 2
  KO
K04834  voltage-gated sodium channel type II alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Disease
H00606  Early infantile epileptic encephalopathy
H02362  Benign familial infantile seizure
Drug target
Actisomide: D02762
Ajmaline: D00199
Aminobenzoic acid (DG00379): D02456 D02906 D02907
Amiodarone (DG00204): D00636<JP/US> D02910
Aprindine (DG00199): D01326<JP> D02969
Articaine (DG00805): D02991 D07468
Benzocaine: D00552<JP>
Bupivacaine (DG00801): D01450<JP/US> D07552<US>
Carbamazepine: D00252<JP/US>
Cenobamate: D11150<US>
Chloroprocaine (DG00800): D00732<US> D07678
Cibenzoline (DG00209): D01455<JP> D03492
Cinchocaine (DG00297): D00733 D02220
Cocaine (DG00808): D00110 D02182<JP/US>
Disopyramide (DG00194): D00303<JP> D00637<JP/US>
Eleclazine: D11155
Encainide (DG00203): D03991 D07894
Eslicarbazepine (DG00848): D09215 D09612<US>
Ethyl piperidinoacetylaminobenzoate: D01519<JP>
Etidocaine (DG00804): D00737 D04095
Flecainide (DG00201): D00638<JP/US> D07962
Fosphenytoin (DG00847): D02096<US> D07595<JP> D07993
Indecainide hydrochloride: D04521
Lamotrigine: D00354<JP/US>
Levobupivacaine (DG00807): D01287<JP> D08116
Levosemotiadil fumarate: D09833
Lidocaine (DG00196): D00358<JP/US> D02086<JP/US> D08127<JP/US>
Lorajmine: D04774
Mephenytoin: D00375
Mepivacaine (DG00802): D00738<JP/US> D08181
Mexiletine (DG00197): D00639<JP/US> D08215
Oxcarbazepine: D00533<US>
Oxetacaine (DG00299): D01152<JP> D08311
Oxybuprocaine (DG00392): D01768<JP> D08319
Phenytoin (DG00846): D00512<JP/US> D02103<JP/US>
Pilsicainide (DG01257): D01554<JP> D08377
Pirmenol (DG01381): D01785<JP> D06517 D08394
Pramocaine (DG00300): D00739 D08407
Prilocaine (DG00803): D00553 D01243<US>
Procainamide (DG00193): D00477<JP/US> D08421
Procaine (DG00298): D00740<JP> D08422
Propafenone (DG00200): D00640<JP/US> D08435
Proxymetacaine (DG01145): D02098<US> D08448
Quinidine (DG00192): D00642<US> D00643 D02272<JP/US> D08458 D08459
Recainam (DG01421): D05708 D05709
Ropivacaine (DG00806): D04048<JP/US> D08490
Rufinamide: D05775<JP/US>
Sparteine (DG00195): D01041 D02239
Tetracaine (DG00296): D00551 D00741<JP/US>
Tocainide (DG00198): D02088 D06172
Topiramate: D00537<JP/US>
Transcainide: D06203
Zonisamide: D00538<JP/US>
p-Butylaminobenzoyldiethylaminoethyl hydrochloride: D01967<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    6326 (SCN2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    6326 (SCN2A)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   6326 (SCN2A)
SSDB
Motif
Pfam: Ion_trans Na_trans_cytopl Na_trans_assoc PKD_channel GPHH ATP-synt_B IQ
Other DBs
NCBI-GeneID: 6326
NCBI-ProteinID: NP_001035232
OMIM: 182390
HGNC: 10588
Ensembl: ENSG00000136531
Vega: OTTHUMG00000044172
Pharos: Q99250(Tclin)
UniProt: Q99250
Structure
PDB: 
6J8E 4JPZ 6BUT 2KAV

Position
2q24.3
AA seq 2005 aa
MAQSVLVPPGPDSFRFFTRESLAAIEQRIAEEKAKRPKQERKDEDDENGPKPNSDLEAGK
SLPFIYGDIPPEMVSVPLEDLDPYYINKKTFIVLNKGKAISRFSATPALYILTPFNPIRK
LAIKILVHSLFNMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFC
LEDFTFLRDPWNWLDFTVITFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGA
LIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSSFEINITSFFNNSL
DGNGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKAGRNP
NYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLI
LAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAAAAAASAESRDFSGAGGI
GVFSESSSVASKLSSKSEKELKNRRKKKKQKEQSGEEEKNDRVRKSESEDSIRRKGFRFS
LEGSRLTYEKRFSSPHQSLLSIRGSLFSPRRNSRASLFSFRGRAKDIGSENDFADDEHST
FEDNDSRRDSLFVPHRHGERRHSNVSQASRASRVLPILPMNGKMHSAVDCNGVVSLVGGP
STLTSAGQLLPEGTTTETEIRKRRSSSYHVSMDLLEDPTSRQRAMSIASILTNTMEELEE
SRQKCPPCWYKFANMCLIWDCCKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAMEH
YPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGL
ANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGM
QLFGKSYKECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCL
TVFMMVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDFVKRK
IREFIQKAFVRKQKALDEIKPLEDLNNKKDSCISNHTTIEIGKDLNYLKDGNGTTSGIGS
SVEKYVVDESDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESDMEESKEKLNATSS
SEGSTVDIGAPAEGEQPEVEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKT
CYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLK
WVAYGFQVYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRF
EGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVV
NNYSECKALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQ
PKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNA
MKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEMT
NILYWINLVFIVLFTGECVLKLISLRYYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFV
SPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMS
NFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPDKDHPGS
SVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYE
VWEKFDPDATQFIEFAKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFA
FTKRVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIIIQRAYRRYL
LKQKVKKVSSIYKKDKGKECDGTPIKEDTLIDKLNENSTPEKTDMTPSTTSPPSYDSVTK
PEKEKFEKDKSEKEDKGKDIRESKK
NT seq 6018 nt   +upstreamnt  +downstreamnt
atggcacagtcagtgctggtaccgccaggacctgacagcttccgcttctttaccagggaa
tcccttgctgctattgaacaacgcattgcagaagagaaagctaagagacccaaacaggaa
cgcaaggatgaggatgatgaaaatggcccaaagccaaacagtgacttggaagcaggaaaa
tctcttccatttatttatggagacattcctccagagatggtgtcagtgcccctggaggat
ctggacccctactatatcaataagaaaacgtttatagtattgaataaagggaaagcaatc
tctcgattcagtgccacccctgccctttacattttaactcccttcaaccctattagaaaa
ttagctattaagattttggtacattctttattcaatatgctcattatgtgcacgattctt
accaactgtgtatttatgaccatgagtaaccctccagactggacaaagaatgtggagtat
acctttacaggaatttatacttttgaatcacttattaaaatacttgcaaggggcttttgt
ttagaagatttcacatttttacgggatccatggaattggttggatttcacagtcattact
tttgcatatgtgacagagtttgtggacctgggcaatgtctcagcgttgagaacattcaga
gttctccgagcattgaaaacaatttcagtcattccaggcctgaagaccattgtgggggcc
ctgatccagtcagtgaagaagctttctgatgtcatgatcttgactgtgttctgtctaagc
gtgtttgcgctaataggattgcagttgttcatgggcaacctacgaaataaatgtttgcaa
tggcctccagataattcttcctttgaaataaatatcacttccttctttaacaattcattg
gatgggaatggtactactttcaataggacagtgagcatatttaactgggatgaatatatt
gaggataaaagtcacttttattttttagaggggcaaaatgatgctctgctttgtggcaac
agctcagatgcaggccagtgtcctgaaggatacatctgtgtgaaggctggtagaaacccc
aactatggctacacgagctttgacacctttagttgggcctttttgtccttatttcgtctc
atgactcaagacttctgggaaaacctttatcaactgacactacgtgctgctgggaaaacg
tacatgatattttttgtgctggtcattttcttgggctcattctatctaataaatttgatc
ttggctgtggtggccatggcctatgaggaacagaatcaggccacattggaagaggctgaa
cagaaggaagctgaatttcagcagatgctcgaacagttgaaaaagcaacaagaagaagct
caggcggcagctgcagccgcatctgctgaatcaagagacttcagtggtgctggtgggata
ggagttttttcagagagttcttcagtagcatctaagttgagctccaaaagtgaaaaagag
ctgaaaaacagaagaaagaaaaagaaacagaaagaacagtctggagaagaagagaaaaat
gacagagtccgaaaatcggaatctgaagacagcataagaagaaaaggtttccgtttttcc
ttggaaggaagtaggctgacatatgaaaagagattttcttctccacaccagtccttactg
agcatccgtggctcccttttctctccaagacgcaacagtagggcgagccttttcagcttc
agaggtcgagcaaaggacattggctctgagaatgactttgctgatgatgagcacagcacc
tttgaggacaatgacagccgaagagactctctgttcgtgccgcacagacatggagaacgg
cgccacagcaatgtcagccaggccagccgtgcctccagggtgctccccatcctgcccatg
aatgggaagatgcatagcgctgtggactgcaatggtgtggtctccctggtcgggggccct
tctaccctcacatctgctgggcagctcctaccagagggcacaactactgaaacagaaata
agaaagagacggtccagttcttatcatgtttccatggatttattggaagatcctacatca
aggcaaagagcaatgagtatagccagtattttgaccaacaccatggaagaacttgaagaa
tccagacagaaatgcccaccatgctggtataaatttgctaatatgtgtttgatttgggac
tgttgtaaaccatggttaaaggtgaaacaccttgtcaacctggttgtaatggacccattt
gttgacctggccatcaccatctgcattgtcttaaatacactcttcatggctatggagcac
tatcccatgacggagcagttcagcagtgtactgtctgttggaaacctggtcttcacaggg
atcttcacagcagaaatgtttctcaagataattgccatggatccatattattactttcaa
gaaggctggaatatttttgatggttttattgtgagccttagtttaatggaacttggtttg
gcaaatgtggaaggattgtcagttctccgatcattccggctgctccgagttttcaagttg
gcaaaatcttggccaactctaaatatgctaattaagatcattggcaattctgtgggggct
ctaggaaacctcaccttggtattggccatcatcgtcttcatttttgctgtggtcggcatg
cagctctttggtaagagctacaaagaatgtgtctgcaagatttccaatgattgtgaactc
ccacgctggcacatgcatgactttttccactccttcctgatcgtgttccgcgtgctgtgt
ggagagtggatagagaccatgtgggactgtatggaggtcgctggccaaaccatgtgcctt
actgtcttcatgatggtcatggtgattggaaatctagtggttctgaacctcttcttggcc
ttgcttttgagttccttcagttctgacaatcttgctgccactgatgatgataacgaaatg
aataatctccagattgctgtgggaaggatgcagaaaggaatcgattttgttaaaagaaaa
atacgtgaatttattcagaaagcctttgttaggaagcagaaagctttagatgaaattaaa
ccgcttgaagatctaaataataaaaaagacagctgtatttccaaccataccaccatagaa
ataggcaaagacctcaattatctcaaagacggaaatggaactactagtggcataggcagc
agtgtagaaaaatatgtcgtggatgaaagtgattacatgtcatttataaacaaccctagc
ctcactgtgacagtaccaattgctgttggagaatctgactttgaaaatttaaatactgaa
gaattcagcagcgagtcagatatggaggaaagcaaagagaagctaaatgcaactagttca
tctgaaggcagcacggttgatattggagctcccgccgagggagaacagcctgaggttgaa
cctgaggaatcccttgaacctgaagcctgttttacagaagactgtgtacggaagttcaag
tgttgtcagataagcatagaagaaggcaaagggaaactctggtggaatttgaggaaaaca
tgctataagatagtggagcacaattggttcgaaaccttcattgtcttcatgattctgctg
agcagtggggctctggcctttgaagatatatacattgagcagcgaaaaaccattaagacc
atgttagaatatgctgacaaggttttcacttacatattcattctggaaatgctgctaaag
tgggttgcatatggttttcaagtgtattttaccaatgcctggtgctggctagacttcctg
attgttgatgtctcactggttagcttaactgcaaatgccttgggttactcagaacttggt
gccatcaaatccctcagaacactaagagctctgaggccactgagagctttgtcccggttt
gaaggaatgagggttgttgtaaatgctcttttaggagccattccatctatcatgaatgta
cttctggtttgtctgatcttttggctaatattcagtatcatgggagtgaatctctttgct
ggcaagttttaccattgtattaattacaccactggagagatgtttgatgtaagcgtggtc
aacaactacagtgagtgcaaagctctcattgagagcaatcaaactgccaggtggaaaaat
gtgaaagtaaactttgataacgtaggacttggatatctgtctctacttcaagtagccacg
tttaagggatggatggatattatgtatgcagctgttgattcacgaaatgtagaattacaa
cccaagtatgaagacaacctgtacatgtatctttattttgtcatctttattatttttggt
tcattctttaccttgaatcttttcattggtgtcatcatagataacttcaaccaacagaaa
aagaagtttggaggtcaagacatttttatgacagaagaacagaagaaatactacaatgca
atgaaaaaactgggttcaaagaaaccacaaaaacccatacctcgacctgctaacaaattc
caaggaatggtctttgattttgtaaccaaacaagtctttgatatcagcatcatgatcctc
atctgccttaacatggtcaccatgatggtggaaaccgatgaccagagtcaagaaatgaca
aacattctgtactggattaatctggtgtttattgttctgttcactggagaatgtgtgctg
aaactgatctctcttcgttactactatttcactattggatggaatatttttgattttgtg
gtggtcattctctccattgtaggaatgtttctggctgaactgatagaaaagtattttgtg
tcccctaccctgttccgagtgatccgtcttgccaggattggccgaatcctacgtctgatc
aaaggagcaaaggggatccgcacgctgctctttgctttgatgatgtcccttcctgcgttg
tttaacatcggcctccttcttttcctggtcatgttcatctacgccatctttgggatgtcc
aattttgcctatgttaagagggaagttgggatcgatgacatgttcaactttgagaccttt
ggcaacagcatgatctgcctgttccaaattacaacctctgctggctgggatggattgcta
gcacctattcttaatagtggacctccagactgtgaccctgacaaagatcaccctggaagc
tcagttaaaggagactgtgggaacccatctgttgggattttcttttttgtcagttacatc
atcatatccttcctggttgtggtgaacatgtacatcgcggtcatcctggagaacttcagt
gttgctactgaagaaagtgcagagcctctgagtgaggatgactttgagatgttctatgag
gtttgggagaagtttgatcccgatgcgacccagtttatagagtttgccaaactttctgat
tttgcagatgccctggatcctcctcttctcatagcaaaacccaacaaagtccagctcatt
gccatggatctgcccatggtgagtggtgaccggatccactgtcttgacatcttatttgct
tttacaaagcgtgttttgggtgagagtggagagatggatgcccttcgaatacagatggaa
gagcgattcatggcatcaaacccctccaaagtctcttatgagcccattacgaccacgttg
aaacgcaaacaagaggaggtgtctgctattattatccagagggcttacagacgctacctc
ttgaagcaaaaagttaaaaaggtatcaagtatatacaagaaagacaaaggcaaagaatgt
gatggaacacccatcaaagaagatactctcattgataaactgaatgagaattcaactcca
gagaaaaccgatatgacgccttccaccacgtctccaccctcgtatgatagtgtgaccaaa
ccagaaaaagaaaaatttgaaaaagacaaatcagaaaaggaagacaaagggaaagatatc
agggaaagtaaaaagtaa

DBGET integrated database retrieval system